DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAAR8 and taar13e

DIOPT Version :9

Sequence 1:NP_444508.1 Gene:TAAR8 / 83551 HGNCID:14964 Length:342 Species:Homo sapiens
Sequence 2:NP_001076512.1 Gene:taar13e / 100034381 ZFINID:ZDB-GENE-041014-70 Length:341 Species:Danio rerio


Alignment Length:332 Identity:139/332 - (41%)
Similarity:212/332 - (63%) Gaps:6/332 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    11 QLCYEDVNGSCIETPYSPGSRVILYTAFSFGSLLAVFGNLLVMTSVLHFKQLHSPTNFLIASLAC 75
            |.|:..||.||::..:...::.::|...:....:.:.||.:|:.|:.|||||.:|||.|:.|||.
Zfish    12 QFCFPAVNNSCLKGTHHVSTQTVVYLVLASAMTVTILGNSVVIISIAHFKQLQTPTNILVMSLAL 76

Human    76 ADFLVGVTVMLFSMVRTVESCWYFGAKFCTLHSCCDVAFCYSSVLHLCFICIDRYIVVTDPLVYA 140
            ||.|:|:.||.|||:|:|:.|||:|..||.|||..|:.....|:.||.||.:||:..|..||.|.
Zfish    77 ADLLLGLVVMPFSMIRSVDGCWYYGETFCLLHSSFDMFLTSVSIFHLIFIAVDRHQAVCFPLQYP 141

Human   141 TKFTVSVSGICISVSWILPLTYSGAVFYTGVNDDGLEELVSALNCVGGCQIIVSQGWVLIDFLL- 204
            |..|:.|:.:.:.:||.:...||..:.|:..|.:||||.:.::.|:|||.::.:..|..||.|: 
Zfish   142 TMITIPVAWVMVIISWSMAAFYSYGLVYSKANVEGLEEYIESIYCMGGCTLLFNALWGAIDTLVA 206

Human   205 FFIPTLVMIILYSKIFLIAKQQAIKI-ETTSSKVESSSESYKIRVAKRERKAAKTLGVTVLAFVI 268
            ||:|..|||.||::||:|||:.|.|: |......|:..:|.:    :.|||||||||:.|.||||
Zfish   207 FFLPCFVMIGLYARIFMIAKKHARKLGEANQHDNENLFKSSR----RSERKAAKTLGIVVGAFVI 267

Human   269 SWLPYTVDILIDAFMGFLTPAYIYEICCWSAYYNSAMNPLIYALFYPWFRKAIKLILSGDVLKAS 333
            .|||:.::.::|.::.|.||..::|...|..|.|||:||:||.||||||||.:.||::..:.:.:
Zfish   268 CWLPFFINSMMDPYINFSTPGVLFEAFVWLGYMNSAINPIIYGLFYPWFRKTLYLIITLRMFEPN 332

Human   334 SSTISLF 340
            ||.|::|
Zfish   333 SSDINVF 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAAR8NP_444508.1 7tm_1 48..310 CDD:278431 116/263 (44%)
taar13eNP_001076512.1 7tm_4 43..>269 CDD:304433 101/229 (44%)
7tm_1 49..309 CDD:278431 116/263 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I36869
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.