| Sequence 1: | NP_113609.1 | Gene: | ODAD4 / 83538 | HGNCID: | 25280 | Length: | 672 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_504200.1 | Gene: | F32D1.3 / 178832 | WormBaseID: | WBGene00017983 | Length: | 774 | Species: | Caenorhabditis elegans |
| Alignment Length: | 330 | Identity: | 68/330 - (20%) |
|---|---|---|---|
| Similarity: | 125/330 - (37%) | Gaps: | 91/330 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Human 220 TVEDLIMTGINYLDTHSNFWRQQKPIYARERDRKLMQEKWLRDHKRRPS-QTAHYILKSLEDIDM 283
Human 284 LLTSGSAEGSLQKAEKVLKKVLEWNKEEVPNKDELVGNLYSCIGNAQIELGQMEAALQSHRKDL- 347
Human 348 ---EIAKEYDLPDAKSRA--LDNIGRVFARVGKFQQAIDTWEEKIPLAKTTLEKT-WLFHEIGRC 406
Human 407 YLEL--------------------------------DQAWQAQNYGEKSQQCAEEEGDIEWQLNA 439
Human 440 SVL--VAQAQVKLRDFESAVNNFEKALERAKLVHNNEAQQAIISALD----DANKGIIRELRKT- 497
Human 498 NYVEN 502 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ODAD4 | NP_113609.1 | TPR 1. /evidence=ECO:0000255 | 13..46 | ||
| TPR_11 | 16..78 | CDD:290150 | |||
| TPR repeat | 16..41 | CDD:276809 | |||
| TPR repeat | 46..76 | CDD:276809 | |||
| TPR 2. /evidence=ECO:0000255 | 48..80 | ||||
| TPR_11 | 49..112 | CDD:290150 | |||
| TPR 3. /evidence=ECO:0000255 | 81..114 | ||||
| TPR repeat | 81..109 | CDD:276809 | |||
| TPR 4. /evidence=ECO:0000255 | 275..311 | 7/35 (20%) | |||
| TPR repeat | 311..349 | CDD:276809 | 8/41 (20%) | ||
| TPR_12 | 316..385 | CDD:290160 | 20/74 (27%) | ||
| TPR 5. /evidence=ECO:0000255 | 320..353 | 10/36 (28%) | |||
| TPR 6. /evidence=ECO:0000255 | 360..393 | 10/34 (29%) | |||
| TPR repeat | 360..385 | CDD:276809 | 8/26 (31%) | ||
| TPR_12 | 361..429 | CDD:290160 | 20/102 (20%) | ||
| TPR 7. /evidence=ECO:0000255 | 397..430 | 9/65 (14%) | |||
| TPR_12 | 398..468 | CDD:290160 | 16/103 (16%) | ||
| TPR repeat | 431..465 | CDD:276809 | 6/35 (17%) | ||
| TPR 8. /evidence=ECO:0000255 | 437..470 | 7/34 (21%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 527..672 | ||||
| F32D1.3 | NP_504200.1 | DUF1736 | 244..316 | CDD:369859 | |
| TPR repeat | 436..464 | CDD:276809 | 3/29 (10%) | ||
| TPR | 448..748 | CDD:223533 | 62/301 (21%) | ||
| TPR repeat | 469..498 | CDD:276809 | 8/32 (25%) | ||
| TPR repeat | 504..531 | CDD:276809 | 7/38 (18%) | ||
| TPR repeat | 537..578 | CDD:276809 | 12/41 (29%) | ||
| TPR repeat | 587..614 | CDD:276809 | 5/26 (19%) | ||
| TPR repeat | 619..647 | CDD:276809 | 2/27 (7%) | ||
| TPR repeat | 655..681 | CDD:276809 | 6/25 (24%) | ||
| TPR repeat | 686..716 | CDD:276809 | 8/21 (38%) | ||
| TPR repeat | 721..748 | CDD:276809 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||