DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASP2 and Decay

DIOPT Version :9

Sequence 1:NP_116764.2 Gene:CASP2 / 835 HGNCID:1503 Length:452 Species:Homo sapiens
Sequence 2:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster


Alignment Length:266 Identity:70/266 - (26%)
Similarity:124/266 - (46%) Gaps:39/266 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   200 GLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAH 264
            |:||:|::....|:|:   |.|.:.|...:....:..|:||....|.|..|:.:.|:..|: ..|
  Fly    56 GIALILNHKDVKGQKQ---RVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVAR-EDH 116

Human   265 RVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGV 329
            ...|..::|::|||.||.:|..| ....::.::..|...||.:|:||||:||||||||...::.|
  Fly   117 SQNDCFVLAVMSHGTEGKVYAKD-MSYPVERLWNPFLGDNCKTLKNKPKLFFIQACRGANLEKAV 180

Human   330 DQQDGKNHAGSPGCEESDAG---KEKLPK---------MRLPTRSDMICGYACLKGTAAMRNTKR 382
                          |.|...   :|.:|:         ..:|:.:|::..|:......:.||...
  Fly   181 --------------EFSSFAVMTRELVPEPAAAVQPITYAIPSTADILVFYSTFDKFFSFRNVDD 231

Human   383 GSWYIEALAQVFSERACD-------MHVADMLVKVNALIK-DREGYAPGTEFHRCKEMSEYCSTL 439
            |||:|::|.:|..:.|.:       :.:..:|..||..:. :.:........::.|||..:.|||
  Fly   232 GSWFIQSLCRVLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNFMSTL 296

Human   440 CRHLYL 445
            .:...|
  Fly   297 TKTFQL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASP2NP_116764.2 CARD_CASP2 32..118 CDD:260040
CASc 192..447 CDD:214521 70/266 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..354 4/29 (14%)
DecayNP_477462.1 CASc 54..302 CDD:237997 69/264 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152731
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.