DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARHGAP24 and RhoGAP18B

DIOPT Version :10

Sequence 1:NP_001020787.2 Gene:ARHGAP24 / 83478 HGNCID:25361 Length:748 Species:Homo sapiens
Sequence 2:NP_573352.2 Gene:RhoGAP18B / 32898 FlyBaseID:FBgn0261461 Length:1317 Species:Drosophila melanogaster


Alignment Length:208 Identity:55/208 - (26%)
Similarity:95/208 - (45%) Gaps:28/208 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   144 EKRYGNRLAPM----------------LVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDC 192
            |::|....||:                :|:.|....:...::::||:|..|...||.||:.....
  Fly  1117 EQKYPLFAAPLSALELNMTDHPNVPRFVVDVCAYIEQPECIEQDGLYRASGNKVLVDELRKKLTH 1181

Human   193 GEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKL-LSKEEEAGVKELAKQVKSL 256
            ...|.:....|:||:.||.|.:.|||..|:|....||      :| .|..::|.::.::.....:
  Fly  1182 VYDPRWLKTDDIHTLTSLHKQFFRELTSPLITQEAYE------RLGRSLNDDAAIERMSLAFDDM 1240

Human   257 PVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVM 321
            |..|.:.|:::.|.|..|.:.|..|:|...|||.|:||.:|.   .:.:.:..|.  :..|..|:
  Fly  1241 PEPNRSTLRFLIRHLTRVAAASASNRMPSTNLAIVWGPCLLS---ANQIQLDIGR--MNMLAKVL 1300

Human   322 ISKHDCLFPKDAE 334
            |..:|.:|..|.|
  Fly  1301 IENYDRIFHPDNE 1313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARHGAP24NP_001020787.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
PH_RhoGap24 18..131 CDD:241530
RhoGAP_ARHGAP22_24_25 131..329 CDD:239855 52/201 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..476
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 582..641
ERM_helical 652..>725 CDD:466641
RhoGAP18BNP_573352.2 RhoGAP 1141..1285 CDD:459875 43/152 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.