DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT5G46630 and stnB

DIOPT Version :9

Sequence 1:NP_974895.1 Gene:AT5G46630 / 834706 AraportID:AT5G46630 Length:441 Species:Arabidopsis thaliana
Sequence 2:NP_001036318.2 Gene:stnB / 4379834 FlyBaseID:FBgn0016975 Length:1262 Species:Drosophila melanogaster


Alignment Length:368 Identity:80/368 - (21%)
Similarity:150/368 - (40%) Gaps:60/368 - (16%)


- Green bases have known domain annotations that are detailed below.


plant   100 FDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKPKDKPVPNATLQVTG 164
            |.:.||..::..:.|...::...|.|...:|:..:|:  :.|..:....|.....:..|..::..
  Fly   834 FAQYAIAGDYEGVKEFGSDLKKLGLPVEHAPQSSQLF--KIGSMNYEDMKQFSVCIEEALFKIPA 896

plant   165 AVGWRREGLAYKKNEVFLDIVESVNLLMSSKGNVLRCDVTGKVLMKCFLSGMPDLKLGLND--KI 227
            .   |...|.||..||.:..|:.:.:....:|.:|:.....::....||:|||.::||:||  :.
  Fly   897 L---RERALTYKMEEVQVTAVDEITVEQDFEGKILKQIARVRLFFLAFLTGMPTIELGVNDMWRQ 958

plant   228 GLEKESEMKSRPAKSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEF-ELMKYRITEGVN-- 289
            |.|........|..:.:.|.|:.|.||..||...:...:|:.|.|||..: ||:::|:....|  
  Fly   959 GKEVVGRHDIIPVATEEWIRLEAVEFHSVVNQKEYERTRTIKFQPPDANYIELLRFRVRPPKNRE 1023

plant   290 LPFRVLPTIKELG-RTRMEVNVKVKSVFGAKMFAL---GVVVKIPVP------------------ 332
            ||.::..|....| :..:..::.|......|:..:   .|.|:.|:|                  
  Fly  1024 LPLQLKATWCVSGNKVELRADILVPGFTSRKLGQIPCEDVSVRFPIPECWIYLFRVEKHFRYGSV 1088

plant   333 ----KQTAKTN----------------FQVTTGRAKYNPSIDCLVWKIRKFPGQTESTLSAEIEL 377
                ::|.|..                .:||:|:|||......:||:..:.|.:.:...:.. :|
  Fly  1089 KSAHRRTGKIKGIERILGAVDTLQESLIEVTSGQAKYEHHHRAIVWRCPRLPKEGQGAYTTH-QL 1152

plant   378 ISTMGEKKSWTRPPIQM------EFQVPMFTASGLRVRFLKVR 414
            :..|. ..|:.:.|.::      ||.:|....|...||.:.|:
  Fly  1153 VCRMA-LTSYDQIPSELAPYAFVEFTMPATQVSHTTVRSVSVQ 1194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT5G46630NP_974895.1 AP-2_Mu2_Cterm 175..413 CDD:271159 66/290 (23%)
stnBNP_001036318.2 Trypan_PARP 377..496 CDD:114603
AP_MHD_Cterm 897..1219 CDD:299401 69/303 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10529
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.