DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHT1;2 and CG33233

DIOPT Version :9

Sequence 1:NP_001190462.1 Gene:PHT1;2 / 834355 AraportID:AT5G43370 Length:524 Species:Arabidopsis thaliana
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:511 Identity:108/511 - (21%)
Similarity:176/511 - (34%) Gaps:123/511 - (24%)


- Green bases have known domain annotations that are detailed below.


plant     9 LKALDVAKTQL---YHFTAIVIAGMGFFTDAYDLFCVSLVTKLLGRIYYFNPESAKPGSLPPHVA 70
            :.|:||....|   |....::|..:.||...|.      ||:.:...|.....|.:..:.|....
  Fly     1 MPAMDVDTALLTIGYGLGQVIIFMVSFFIYMYS------VTESMTAGYLVVLTSCEFDTSPKEKT 59

plant    71 AAVNGVALCGTLSGQLFFGWLGDKLGRKKVYGLTLIMMILCSVASGLSFGNEAKGVMTTLCFFRF 135
            ...|.: |.|.::..||.|:|.|:.|||.|..|.|:..:..||.|.|      ...:.:|...|.
  Fly    60 LLANSL-LGGMVASGLFIGFLADRYGRKFVIRLALVGALSFSVISAL------MPDLYSLSVIRI 117

plant   136 WLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGVGILAGGFVALAVSSIFDKKFPAPTYA 200
            .:|..:.....|....:.|:...|.|...:|.....||:.::....||:|   |....|      
  Fly   118 IVGTFLSAVASLQVGFLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMA---ILPNNF------ 173

plant   201 VNRALSTPPQVDYIWRIIVMFGALPAALTYYWRMKMPETARYTALVAKNIKQATA-------DMS 258
             |..||:...: .:||.::||..:|..|.......:|||..:...|.:..|...|       :..
  Fly   174 -NVDLSSSYNL-RVWRFLMMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRK 236

plant   259 KVLQTDIELEERVEDDVKDPRQNYGLFSKEFLRRHGLHLLGTTSTWFLLDIAFYSQNLFQKDI-- 321
            |....||.|.|.     |....:...|.|              :.|:...:.|...::|:..|  
  Fly   237 KWEDVDITLSEE-----KSSTNDQEGFWK--------------TVWYEYKLLFSKPHVFKFFICL 282

plant   322 -------FSAIG---WIPKAATMNATHEVFRIARAQTLIALCSTVPGYWFTVAFI-----DTIG- 370
                   |::||   |.|....|:.       :.:..|..|.:..|      .||     ||.| 
  Fly   283 FLIFGIFFTSIGLGIWFPVIRNMDN-------SGSNRLCDLVNNNP------TFINHEADDTNGT 334

plant   371 -----RFKIQLN--------GFFMMTVFMFAIAFPYNHWIKPENRIGFVVMYS------------ 410
                 :...::.        ||..:..|:.|....  ||:..:..|...::.|            
  Fly   335 DSESPKCNDEMTNLIDPVYYGFTYIGCFILASVLV--HWMTRKYVIALHILISMILGISLNIMKQ 397

plant   411 ----LTFFFANFG------PNATTFIVPAEIFPARLRSTCHGISAAAGKAGAIIGA 456
                |.||.....      |.||:.:|  :..|..||.....:..:..:.|.::|:
  Fly   398 PTVVLIFFVLMMVLPGVLIPLATSVLV--DCLPVNLRGKALCMVRSLARFGGVLGS 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHT1;2NP_001190462.1 2A0109 11..516 CDD:129965 108/509 (21%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 102/488 (21%)
MFS 23..>208 CDD:119392 50/208 (24%)
MFS 354..>482 CDD:304372 20/102 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.