Sequence 1: | NP_001182317.1 | Gene: | FCRL5 / 83416 | HGNCID: | 18508 | Length: | 998 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001163838.2 | Gene: | dpr21 / 8674044 | FlyBaseID: | FBgn0260995 | Length: | 282 | Species: | Drosophila melanogaster |
Alignment Length: | 255 | Identity: | 54/255 - (21%) |
---|---|---|---|
Similarity: | 87/255 - (34%) | Gaps: | 53/255 - (20%) |
- Green bases have known domain annotations that are detailed below.
Human 653 IVPVSR-----PIL-TFRAPRAQAVVGDLLELHCEALRGSSPILYWFYHEDVTLGKISAPS---- 707
Human 708 ----------GGGASFNLSL-TTEHSGIYSCEADNGLEAQRSEMVTLKVAVPVSRPVLT-LRAPG 760
Human 761 THAAVGDLLELHCEALR-GSPLILYRFFHEDVTLGNRSSPSGGASL---NLSLTAEH-------- 813
Human 814 --SGNYSCEADNGLGAQRSETVTLYITGLTANRSGPFATGVAGGLLSIAGLAAGALLLYC 871 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FCRL5 | NP_001182317.1 | Ig1_FcgammaR_like | 23..100 | CDD:143229 | |
IG_like | 29..106 | CDD:214653 | |||
Ig_2 | 105..185 | CDD:290606 | |||
IG_like | 110..185 | CDD:214653 | |||
Ig_3 | 191..262 | CDD:290638 | |||
Ig_2 | 287..373 | CDD:290606 | |||
IG_like | 300..373 | CDD:214653 | |||
Ig_2 | 380..466 | CDD:290606 | |||
IG_like | 393..466 | CDD:214653 | |||
Ig_2 | 473..559 | CDD:290606 | |||
IG_like | 486..561 | CDD:214653 | |||
Ig_3 | 565..638 | CDD:290638 | |||
IG_like | 577..652 | CDD:214653 | |||
Ig_3 | 658..731 | CDD:290638 | 19/93 (20%) | ||
IG_like | 670..745 | CDD:214653 | 17/89 (19%) | ||
Ig_2 | 754..835 | CDD:290606 | 22/95 (23%) | ||
IG_like | 759..837 | CDD:214653 | 21/91 (23%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 879..898 | ||||
ITIM motif 1 | 897..902 | ||||
dpr21 | NP_001163838.2 | Ig | 71..149 | CDD:299845 | 15/83 (18%) |
IG_like | 71..140 | CDD:214653 | 14/74 (19%) | ||
IG_like | 162..249 | CDD:214653 | 21/91 (23%) | ||
IGc2 | 169..242 | CDD:197706 | 18/77 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |