DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCRL5 and dpr21

DIOPT Version :9

Sequence 1:NP_001182317.1 Gene:FCRL5 / 83416 HGNCID:18508 Length:998 Species:Homo sapiens
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:255 Identity:54/255 - (21%)
Similarity:87/255 - (34%) Gaps:53/255 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   653 IVPVSR-----PIL-TFRAPRAQAVVGDLLELHCEALRGSSPILYWFYHEDVTLGKISAPS---- 707
            |||:.|     |.. |.......::||....|:|......:..:.|..|.|:.|..:|..:    
  Fly    40 IVPMKRVLDRGPYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSD 104

Human   708 ----------GGGASFNLSL-TTEHSGIYSCEADNGLEAQRSEMVTLKVAVPVSRPVLT-LRAPG 760
                      .|..|..:.. ....||||.|:...      :..|...:...|..|:.: |..|.
  Fly   105 QRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVST------TPPVGYTMVFSVVEPITSILGGPE 163

Human   761 THAAVGDLLELHCEALR-GSPLILYRFFHEDVTLGNRSSPSGGASL---NLSLTAEH-------- 813
            .:..:|..:.|.|.... ..|.|..::.|.:..: |..||.||.|:   ...:|..:        
  Fly   164 IYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEI-NYDSPRGGVSVITEKGDITTSYLLIQRASI 227

Human   814 --SGNYSCEADNGLGAQRSETVTLYITGLTANRSGPFATGVAGGLLSIAGLAAGALLLYC 871
              ||.|:|...|.    .|::|.::|.      .|.....|....|.::.|.:...|..|
  Fly   228 ADSGQYTCLPSNA----NSKSVNVHIL------KGDHPAAVQKSHLLVSELLSLCFLQIC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCRL5NP_001182317.1 Ig1_FcgammaR_like 23..100 CDD:143229
IG_like 29..106 CDD:214653
Ig_2 105..185 CDD:290606
IG_like 110..185 CDD:214653
Ig_3 191..262 CDD:290638
Ig_2 287..373 CDD:290606
IG_like 300..373 CDD:214653
Ig_2 380..466 CDD:290606
IG_like 393..466 CDD:214653
Ig_2 473..559 CDD:290606
IG_like 486..561 CDD:214653
Ig_3 565..638 CDD:290638
IG_like 577..652 CDD:214653
Ig_3 658..731 CDD:290638 19/93 (20%)
IG_like 670..745 CDD:214653 17/89 (19%)
Ig_2 754..835 CDD:290606 22/95 (23%)
IG_like 759..837 CDD:214653 21/91 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 879..898
ITIM motif 1 897..902
dpr21NP_001163838.2 Ig 71..149 CDD:299845 15/83 (18%)
IG_like 71..140 CDD:214653 14/74 (19%)
IG_like 162..249 CDD:214653 21/91 (23%)
IGc2 169..242 CDD:197706 18/77 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.