DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCRL5 and dpr5

DIOPT Version :9

Sequence 1:NP_001182317.1 Gene:FCRL5 / 83416 HGNCID:18508 Length:998 Species:Homo sapiens
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:228 Identity:54/228 - (23%)
Similarity:91/228 - (39%) Gaps:49/228 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   461 AVSLSVTVPVSH----PVL-TLSSAEALTFEGATVTLHCEVQRGSPQILYQFYHEDMPLWSSSTP 520
            |..||..:|.::    ||. ..:..|.:...|.|..|||.|:....:.:......|:.:.     
  Fly    74 AEELSNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHIL----- 133

Human   521 SVGRVSFS--------------------FSLTEGHSGNYYCTADNGFGPQRSEVVSLFVTVPVSR 565
            ::|.::::                    .|:.:..:|.|.|....  .|:.|....| |.|....
  Fly   134 TIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVST--EPKISLAYKL-VVVTSKA 195

Human   566 PILTLRVPRAQAVVGDLLELHCEAPRGSPPILYWFYHEDVTLGSSSAPSGGEA-------SFNLS 623
            .||..|....|:  |..:.|.|.||:...|..:..:|:|..|.|.||..|...       :.||.
  Fly   196 QILANRELFIQS--GSDINLTCIAPQAPGPYTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLV 258

Human   624 LT-AEH--SGNYSCEANNGLVAQHSDTISLSVI 653
            :: .:|  ||||:|.|:|    .:||::.:.:|
  Fly   259 ISRVQHTDSGNYTCSADN----SNSDSVFVHII 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCRL5NP_001182317.1 Ig1_FcgammaR_like 23..100 CDD:143229
IG_like 29..106 CDD:214653
Ig_2 105..185 CDD:290606
IG_like 110..185 CDD:214653
Ig_3 191..262 CDD:290638
Ig_2 287..373 CDD:290606
IG_like 300..373 CDD:214653
Ig_2 380..466 CDD:290606 2/4 (50%)
IG_like 393..466 CDD:214653 2/4 (50%)
Ig_2 473..559 CDD:290606 18/106 (17%)
IG_like 486..561 CDD:214653 16/94 (17%)
Ig_3 565..638 CDD:290638 26/82 (32%)
IG_like 577..652 CDD:214653 25/84 (30%)
Ig_3 658..731 CDD:290638
IG_like 670..745 CDD:214653
Ig_2 754..835 CDD:290606
IG_like 759..837 CDD:214653
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 879..898
ITIM motif 1 897..902
dpr5NP_650080.3 V-set 95..191 CDD:284989 17/103 (17%)
IG_like 98..179 CDD:214653 13/87 (15%)
IG_like 206..278 CDD:214653 24/77 (31%)
Ig 211..278 CDD:143165 22/70 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.