Sequence 1: | NP_001182317.1 | Gene: | FCRL5 / 83416 | HGNCID: | 18508 | Length: | 998 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262320.1 | Gene: | dpr11 / 40800 | FlyBaseID: | FBgn0053202 | Length: | 360 | Species: | Drosophila melanogaster |
Alignment Length: | 230 | Identity: | 52/230 - (22%) |
---|---|---|---|
Similarity: | 87/230 - (37%) | Gaps: | 59/230 - (25%) |
- Green bases have known domain annotations that are detailed below.
Human 204 GNPVTLTCETQLSLERSDVPLRFR-----------FFRDDQTLGLG-----WSLSPNFQITAMWS 252
Human 253 KDSGFYWCKAATMPYSVISDSPRSWIQVQIPASHPVLTLSPEKALNFEGTKVTLHCETQEDSLR- 316
Human 317 -TLYRFYHEGVPL-----RHKSV------------RCERGASISFSLTTENSGNYYCTADNGLGA 363
Human 364 KPSKAVSLSVTVPVSHPVLNLSSPEDLIFEGAKVT 398 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FCRL5 | NP_001182317.1 | Ig1_FcgammaR_like | 23..100 | CDD:143229 | |
IG_like | 29..106 | CDD:214653 | |||
Ig_2 | 105..185 | CDD:290606 | |||
IG_like | 110..185 | CDD:214653 | |||
Ig_3 | 191..262 | CDD:290638 | 17/73 (23%) | ||
Ig_2 | 287..373 | CDD:290606 | 24/104 (23%) | ||
IG_like | 300..373 | CDD:214653 | 23/91 (25%) | ||
Ig_2 | 380..466 | CDD:290606 | 4/19 (21%) | ||
IG_like | 393..466 | CDD:214653 | 2/6 (33%) | ||
Ig_2 | 473..559 | CDD:290606 | |||
IG_like | 486..561 | CDD:214653 | |||
Ig_3 | 565..638 | CDD:290638 | |||
IG_like | 577..652 | CDD:214653 | |||
Ig_3 | 658..731 | CDD:290638 | |||
IG_like | 670..745 | CDD:214653 | |||
Ig_2 | 754..835 | CDD:290606 | |||
IG_like | 759..837 | CDD:214653 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 879..898 | ||||
ITIM motif 1 | 897..902 | ||||
dpr11 | NP_001262320.1 | I-set | 125..216 | CDD:254352 | 21/91 (23%) |
Ig | 127..217 | CDD:299845 | 22/92 (24%) | ||
IG_like | 227..320 | CDD:214653 | 24/106 (23%) | ||
IGc2 | 234..311 | CDD:197706 | 19/81 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |