| Sequence 1: | NP_001182317.1 | Gene: | FCRL5 / 83416 | HGNCID: | 18508 | Length: | 998 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
| Alignment Length: | 308 | Identity: | 79/308 - (25%) |
|---|---|---|---|
| Similarity: | 124/308 - (40%) | Gaps: | 52/308 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Human 280 VQIPASHPVLTLSPEKALNFEGTKVTLHCETQEDSLR-----TLYRFYHEGVPLRHKSVRCERGA 339
Human 340 SISFSLTTENSGNYYCTADNGLGAKPSKAVSLSVTVPVSHPVLNLSSPEDLI-FEGAKVTLHCEA 403
Human 404 QRGSLPILYQFHHEGAALERRSANSAGGVAISFSLTAEHSGNYYCTADNGFGPQRSKAVSLSVTV 468
Human 469 PVSH-PVLTLSS---AEALTFEGATVTLHCEVQRGSPQILYQFYHEDMPLWSSSTPSVGRVSFSF 529
Human 530 SLTEG----------HSGNYYCTADNGFGPQRSEVVSLFVT-VPVSRP 566 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| FCRL5 | NP_001182317.1 | Ig1_FcgammaR_like | 23..100 | CDD:143229 | |
| IG_like | 29..106 | CDD:214653 | |||
| Ig_2 | 105..185 | CDD:290606 | |||
| IG_like | 110..185 | CDD:214653 | |||
| Ig_3 | 191..262 | CDD:290638 | |||
| Ig_2 | 287..373 | CDD:290606 | 20/90 (22%) | ||
| IG_like | 300..373 | CDD:214653 | 16/77 (21%) | ||
| Ig_2 | 380..466 | CDD:290606 | 26/86 (30%) | ||
| IG_like | 393..466 | CDD:214653 | 23/72 (32%) | ||
| Ig_2 | 473..559 | CDD:290606 | 21/98 (21%) | ||
| IG_like | 486..561 | CDD:214653 | 18/85 (21%) | ||
| Ig_3 | 565..638 | CDD:290638 | 1/2 (50%) | ||
| IG_like | 577..652 | CDD:214653 | |||
| Ig_3 | 658..731 | CDD:290638 | |||
| IG_like | 670..745 | CDD:214653 | |||
| Ig_2 | 754..835 | CDD:290606 | |||
| IG_like | 759..837 | CDD:214653 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 879..898 | ||||
| ITIM motif 1 | 897..902 | ||||
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 22/97 (23%) |
| FR1 | 37..50 | CDD:409353 | |||
| Ig strand A' | 37..42 | CDD:409353 | |||
| Ig strand B | 44..51 | CDD:409353 | |||
| CDR1 | 51..59 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 59..63 | CDD:409353 | 2/3 (67%) | ||
| FR2 | 60..63 | CDD:409353 | 2/2 (100%) | ||
| CDR2 | 67..81 | CDD:409353 | 4/13 (31%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 9/49 (18%) | ||
| Ig strand D | 84..90 | CDD:409353 | 3/5 (60%) | ||
| Ig strand E | 94..102 | CDD:409353 | 2/14 (14%) | ||
| Ig strand F | 108..115 | CDD:409353 | 3/6 (50%) | ||
| CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
| FR4 | 124..130 | CDD:409353 | 2/5 (40%) | ||
| Ig strand G | 124..130 | CDD:409353 | 2/5 (40%) | ||
| Ig_3 | 134..208 | CDD:404760 | 22/76 (29%) | ||
| Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 166..170 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 187..191 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 201..206 | CDD:409353 | 3/4 (75%) | ||
| Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
| Ig | 227..318 | CDD:416386 | 19/95 (20%) | ||
| Ig strand C | 256..260 | CDD:409353 | 0/4 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||