DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCRL5 and dpr2

DIOPT Version :9

Sequence 1:NP_001182317.1 Gene:FCRL5 / 83416 HGNCID:18508 Length:998 Species:Homo sapiens
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:222 Identity:48/222 - (21%)
Similarity:67/222 - (30%) Gaps:65/222 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    21 PRPII-FLQPPWTTVFQGERVTLTCKGFRFYSPQKTKWYHR----YLGKEILRETPDNILEV--- 77
            |.|:. |..|...|...|....:.|:.... ..:...|..:    .|...||..|.|...:|   
  Fly   104 PPPVFDFGMPRNITTRTGHTAAINCRVDNL-GDKSVSWIRKRDLHILTAGILTYTSDERFKVVRT 167

Human    78 ---------------QESGEYRCQAQGSP-LSSPVHLDF----SSASLILQAP--LSVFEGDSVV 120
                           ::||.|.||....| :|....|:.    ..|..|:..|  |.|..|.||.
  Fly   168 ADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVT 232

Human   121 LRCRAKAEVTLNNTI-----YKNDNVLA-FLNKRTD---------------------FHIPHACL 158
            |.|..|...|....|     |:...:|. |:....|                     ..|.:|.|
  Fly   233 LTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQL 297

Human   159 KDNGAYRCTGYKESCCPVSSNTVKIQV 185
            .|.|.|       :|.|.::....:.|
  Fly   298 LDTGNY-------TCMPTTAEAASVVV 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCRL5NP_001182317.1 Ig1_FcgammaR_like 23..100 CDD:143229 21/100 (21%)
IG_like 29..106 CDD:214653 20/103 (19%)
Ig_2 105..185 CDD:290606 24/108 (22%)
IG_like 110..185 CDD:214653 23/103 (22%)
Ig_3 191..262 CDD:290638
Ig_2 287..373 CDD:290606
IG_like 300..373 CDD:214653
Ig_2 380..466 CDD:290606
IG_like 393..466 CDD:214653
Ig_2 473..559 CDD:290606
IG_like 486..561 CDD:214653
Ig_3 565..638 CDD:290638
IG_like 577..652 CDD:214653
Ig_3 658..731 CDD:290638
IG_like 670..745 CDD:214653
Ig_2 754..835 CDD:290606
IG_like 759..837 CDD:214653
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 879..898
ITIM motif 1 897..902
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 19/93 (20%)
Ig 116..192 CDD:299845 14/76 (18%)
ig 220..306 CDD:278476 21/92 (23%)
IG_like 220..306 CDD:214653 21/92 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.