DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASP1 and Drice

DIOPT Version :9

Sequence 1:NP_001244047.1 Gene:CASP1 / 834 HGNCID:1499 Length:404 Species:Homo sapiens
Sequence 2:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster


Alignment Length:348 Identity:93/348 - (26%)
Similarity:142/348 - (40%) Gaps:69/348 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    88 GLSADQTS---GNYLNMQDSQGVLSSFPAPQA----VQDNPAMPTSSGSEG-------------- 131
            |.||||..   ||.....|....|.|..:..|    :....:.|..||:.|              
  Fly     7 GESADQVGIRVGNPEQPNDHTDALGSVGSGGAGSSGLVAGSSHPYGSGAIGQLANGYSSPSSSYR 71

Human   132 -NVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFD--SIPRRTGAEVDITGMTMLL 193
             ||       |:.:..:.:|| |.:..|:  ..:|||..:|.|:  ::..|.|..||...:|.:|
  Fly    72 KNV-------AKMVTDRHAAE-YNMRHKN--RGMALIFNHEHFEVPTLKSRAGTNVDCENLTRVL 126

Human   194 QNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQL 258
            :.|.:.|.|.|:....|:...:| :|....|..||...:..:||| ..|....|.::     .:|
  Fly   127 KQLDFEVTVYKDCRYKDILRTIE-YAASQNHSDSDCILVAILSHG-EMGYIYAKDTQ-----YKL 184

Human   259 NAIFNMLNTKNCPSLKDKPKVIIIQACRGD--SPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKA 321
            :.|::.....:||||..|||:..||||:||  ..||...:......|:.|:.          .|.
  Fly   185 DNIWSFFTANHCPSLAGKPKLFFIQACQGDRLDGGVTMQRSQTETDGDSSMS----------YKI 239

Human   322 HIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIF----RKVRFSFEQ--P 380
            .:..||:...|:.|...|||:.|.||.|:..|...:.......|:..:.    ::|...||.  |
  Fly   240 PVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQRVAVDFESCTP 304

Human   381 D-----GRAQMP--TTERVTLTR 396
            |     .:.|:|  ||   .|||
  Fly   305 DTPEMHQQKQIPCITT---MLTR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASP1NP_001244047.1 CARD_CASP1-like 5..87 CDD:260036
CASc 153..402 CDD:214521 73/261 (28%)
DriceNP_524551.2 CASc 86..330 CDD:214521 73/261 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.