DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASP1 and Decay

DIOPT Version :9

Sequence 1:NP_001244047.1 Gene:CASP1 / 834 HGNCID:1499 Length:404 Species:Homo sapiens
Sequence 2:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster


Alignment Length:278 Identity:72/278 - (25%)
Similarity:107/278 - (38%) Gaps:59/278 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   157 DKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHR 221
            :..:|..:|||:.:::.....:|.|.|.|...|...||..|:.|....:||.|::...|:..| |
  Fly    50 ENCARAGIALILNHKDVKGQKQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVA-R 113

Human   222 PEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACR 286
            .:|..:|...|..||||....:..|..|..|      ..::|.....||.:||:|||:..|||||
  Fly   114 EDHSQNDCFVLAVMSHGTEGKVYAKDMSYPV------ERLWNPFLGDNCKTLKNKPKLFFIQACR 172

Human   287 GDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHI-----------------EKDFIAFCSST 334
            |                 .:|....||...|:....:                 ..|.:.|.|:.
  Fly   173 G-----------------ANLEKAVEFSSFAVMTRELVPEPAAAVQPITYAIPSTADILVFYSTF 220

Human   335 PDNVSWRHPTMGSVFIGRLIEHM-----QEYACSCDVE------EIFRKVRFSF------EQPDG 382
            ....|:|:...||.||..|...:     .|.|....||      .:.|||.:.:      |..:.
  Fly   221 DKFFSFRNVDDGSWFIQSLCRVLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQ 285

Human   383 RAQMPTTERVTLTRCFYL 400
            ..:||.. ..|||:.|.|
  Fly   286 MKEMPNF-MSTLTKTFQL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASP1NP_001244047.1 CARD_CASP1-like 5..87 CDD:260036
CASc 153..402 CDD:214521 72/278 (26%)
DecayNP_477462.1 CASc 54..302 CDD:237997 71/272 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152745
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.