DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASP1 and Strica

DIOPT Version :9

Sequence 1:NP_001244047.1 Gene:CASP1 / 834 HGNCID:1499 Length:404 Species:Homo sapiens
Sequence 2:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster


Alignment Length:317 Identity:74/317 - (23%)
Similarity:128/317 - (40%) Gaps:56/317 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    89 LSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIY 153
            ||:..|...::::..|.|......|....||  |..|.|.|.| :...||.:.    |.|.|.:|
  Fly   259 LSSTATPKPFISLGSSGGTKPKVTAVAQSQD--AQGTISTSLG-ISKSSLTKN----KLKPARVY 316

Human   154 PIMDKSSRTRLALIICNEEFDSIPR-RTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTT--EL 215
                         |..:|.||:... |.|:..|:..:....:.|...|:|   :|.:.:.|  :.
  Fly   317 -------------IFNHERFDNKNEFRKGSAQDVKVLRATFEQLKCKVEV---ITDATLVTIKKT 365

Human   216 EAFAHRPEHKTSDSTFLVFMSHGIR-EGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKV 279
            .......:.:...:..||.:|||.| :.|..|.....:.|    :.:|.:|..:   :||||||:
  Fly   366 VRMLQTKDFEDKSALVLVILSHGTRHDQIAAKDDDYSLDD----DVVFPILRNR---TLKDKPKL 423

Human   280 IIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPT 344
            |.:|||:||.....:..|:...:|:         .::.:|.....:.|::|  .|.|        
  Fly   424 IFVQACKGDCQLGGFMTDAAQPNGS---------PNEILKCYSTYEGFVSF--RTED-------- 469

Human   345 MGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLF 401
             |:.||..|.|.:.....:.|::.|...||...:......|:|:......::  |:|
  Fly   470 -GTPFIQTLCEALNRSGKTSDIDTIMMNVRQVVKMQSKDRQIPSVTSTLTSK--YVF 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASP1NP_001244047.1 CARD_CASP1-like 5..87 CDD:260036
CASc 153..402 CDD:214521 56/253 (22%)
StricaNP_001260718.1 CASc 311..523 CDD:294037 57/256 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.