DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASP1 and csp-2

DIOPT Version :9

Sequence 1:NP_001244047.1 Gene:CASP1 / 834 HGNCID:1499 Length:404 Species:Homo sapiens
Sequence 2:NP_001370851.1 Gene:csp-2 / 177391 WormBaseID:WBGene00000820 Length:826 Species:Caenorhabditis elegans


Alignment Length:325 Identity:83/325 - (25%)
Similarity:135/325 - (41%) Gaps:61/325 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    94 TSGNYLNMQDSQGV--LSSFPAPQA-VQDNPAMP---TSS------------GSEGNVKLCSLEE 140
            ||.:.|....:...  .|..||||| ...:||.|   |||            |..|:....|.||
 Worm   497 TSSSSLTQDPASNATGFSDVPAPQAPPTPSPADPGPTTSSSSLTQDPASNATGFSGSSPPNSFEE 561

Human   141 AQRIWKQKS-------AEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGY 198
            .:.:.:..|       ...|. .::||:.| |:||.|..|..:.:|.|::.|...::.|.:.|||
 Worm   562 TRMMCEDASDGKKIDETRKYR-NNRSSKCR-AIIINNVVFCGMEKRIGSDKDKKKLSKLFERLGY 624

Human   199 SVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSH---GIREGICGKKHSEQVPDILQLNA 260
            ......||.:|::   ||......:....||..:..|||   |:..|:.|      ||  :|:..
 Worm   625 QSTSYDNLKSSEI---LETVRQFTQSNHGDSLIITIMSHGDQGLLYGVDG------VP--VQMLD 678

Human   261 IFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLS-----LPTTEEFEDDAI-- 318
            |.:::.|   .||..|||.::...||||.     ...:|...|.:.     .|...:|.....  
 Worm   679 IIDLMCT---ASLAKKPKWLMCVCCRGDR-----IDRAVRCDGFIDNFFDRFPKFFQFMKSKFPS 735

Human   319 -KKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRL----IEHMQEYACSCDVEEIFRKVRFSFE 378
             :.:..:.|.:...|::|..:|:|..|.|:.:|..|    ||:.::...:..:.|..|:|...:|
 Worm   736 HQTSSSQADLLVSFSTSPGFLSFRDETKGTWYIQELYRVIIENAKDTHLADLLMETNRRVVEKYE 800

Human   379  378
             Worm   801  800

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASP1NP_001244047.1 CARD_CASP1-like 5..87 CDD:260036
CASc 153..402 CDD:214521 62/241 (26%)
csp-2NP_001370851.1 pneumo_PspA 239..>533 CDD:411490 12/35 (34%)
PHA03418 <475..>563 CDD:177646 20/65 (31%)
CASc 581..824 CDD:237997 62/241 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161461451
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.