DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Siglece and side-II

DIOPT Version :9

Sequence 1:XP_006541381.1 Gene:Siglece / 83382 MGIID:1932475 Length:520 Species:Mus musculus
Sequence 2:NP_001014485.3 Gene:side-II / 3346206 FlyBaseID:FBgn0259213 Length:1064 Species:Drosophila melanogaster


Alignment Length:282 Identity:62/282 - (21%)
Similarity:106/282 - (37%) Gaps:53/282 - (18%)


- Green bases have known domain annotations that are detailed below.


Mouse    67 WYREGTDRRKDSIVATNNPIRKAVKETRNRFFLLGDPWRNDCSLNIREIRKKDAGLYFFRLERGK 131
            ||:.....|:     |.:.|.|  ..||:....:.....:..|:..|.......|||   ||.  
  Fly   305 WYKGKRQLRR-----TKDDISK--NSTRSELSFVPTTDDDGKSITCRAENPNVNGLY---LET-- 357

Mouse   132 TKYNYMWDKMTLVVTALT--NTPQILLPETLEAGHPSNLTCSVPWDCGWTAPPIFSWTGTSVSFL 194
                 || |:.:|...|.  .....|.|:.::.|......|.|..:..|..   ..|....: .|
  Fly   358 -----MW-KLNV
VYPPLVTLRLGSTLTPDDIKEGDDVYFECHVQSNPQWRK---LLWLHNGI-HL 412

Mouse   195 STNTTGSSV-----LTITPQPQDHGTNLTCQ-VTLPGTNVSTRMTIRLNVSYAPKNLTVTIYQGA 253
            ..||:...:     |.:....:.:..|..|. :...|..||.::.:|  |.|.|      :.:.|
  Fly   413 EHNTSARVIRSNQSLVLQKITKHYAGNYACSAINDEGETVSNQLPLR--VKYTP------MCKHA 469

Mouse   254 DSVSTILKNGSSLPISEGQSLRLICSTDS-YPPANLSWSWDN----LTLCPSKLSKPG---LLEL 310
            |.|..|   |:    |:.:::.::|...: .||....|.::|    |.:...:.|..|   :|:.
  Fly   470 DRVILI---GA----SKDETVEVVCEIQADPPPRTFRWKFNNSGETLDVGSERFSVNGSRSILKY 527

Mouse   311 FPVHLKHGGVYTCQAQHALGSQ 332
            .||..:..|..:|.|.:.:|:|
  Fly   528 TPVTDQDYGTLSCWASNEVGTQ 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SigleceXP_006541381.1 Ig 25..146 CDD:386229 19/78 (24%)
Ig 152..225 CDD:386229 13/78 (17%)
Ig_3 264..326 CDD:372822 14/69 (20%)
side-IINP_001014485.3 IG_like 55..160 CDD:214653
Ig 57..160 CDD:299845
Ig 188..251 CDD:299845
Ig 289..363 CDD:299845 18/75 (24%)
IG_like 289..351 CDD:214653 10/52 (19%)
Ig_2 376..460 CDD:290606 17/89 (19%)
IG_like 383..454 CDD:214653 13/74 (18%)
Ig 470..548 CDD:299845 19/84 (23%)
IG_like 481..557 CDD:214653 16/69 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.