DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment XGD1 and sotv

DIOPT Version :9

Sequence 1:NP_198314.2 Gene:XGD1 / 833302 AraportID:AT5G33290 Length:500 Species:Arabidopsis thaliana
Sequence 2:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster


Alignment Length:388 Identity:84/388 - (21%)
Similarity:139/388 - (35%) Gaps:134/388 - (34%)


- Green bases have known domain annotations that are detailed below.


plant   142 YVSSLYKNPAAFHQSHT------EMMNRFKVWTYTEGEVPLFHDGPVNDIYGIEGQFMDEMCVDG 200
            ::..|..||.|..::..      :.:|.:|          ..||.....||.:: :|:||   ..
  Fly    73 HIQELAVNPEAEQRARNVNCTFWDCLNIYK----------CEHDRLKVYIYPLQ-EFVDE---QS 123

plant   201 PKS----------------RSRFRADRPENAHVFFIPFSVAKVIHFVYKPITSVEGFSRARLHRL 249
            .|:                :||:....|..| ..|:|                       .|..|
  Fly   124 DKTATTLSSEYFQILEAVLKSRYYTSNPNEA-CLFLP-----------------------SLDLL 164

plant   250 IEDYVDVVATKH---------PYWNRSQGGDHFMVS-------CHDWAPDVIDGNPKLFEKFIRG 298
            .::..|    ||         .:|:|  |.:|.:.:       .::...||...|..:|.     
  Fly   165 NQNVFD----KHLAGAALASLDFWDR--GANHIIFNMLPGGAPSYNTVLDVNTDNAIIFG----- 218

plant   299 LCNANTSEGFRPNVDVSIPEIYLP-------------KGKLGPSFLGKSPR-VRSILAFFAGRSH 349
              ....|..:||..||:|| ::.|             |..|..:.|...|| ||::...  ..:|
  Fly   219 --GGFDSWSYRPGFDVAIP-VWSPRLVRQHAHATAQRKFLLVVAQLNILPRFVRTLREL--SLAH 278

plant   350 GE--------------IRKILFQHWKEMDNEVQVYDRLPPGKDYTKTMGMSKFCLCPSGWEVASP 400
            .|              :|..|.||.|.:              :|.:.:...||||......:..|
  Fly   279 SEQLLLLGACENLDLTMRCPLSQHHKSL--------------EYPRLLSRGKFCLLGRSLRMGQP 329

plant   401 REVEAIYAGCVPVIISDNYSLPFSDVLNWDSFSIQIPVSRIKEIKTILQSVSLVRYLKMYKRV 463
            ..||.:...|:|||..|||.|||.||::|...|::|..:.:..:...|:::|.|:.::|.|:|
  Fly   330 DLVEIMSQHCIPVIAVDNYVLPFEDVIDWSLASVRIRENELHSVMQKLKAISSVKIVEMQKQV 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XGD1NP_198314.2 Exostosin 160..451 CDD:281069 75/350 (21%)
sotvNP_725536.1 Exostosin 105..380 CDD:281069 73/332 (22%)
Glyco_transf_64 455..689 CDD:286358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.