DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARS1 and eEF1beta

DIOPT Version :9

Sequence 1:XP_024304469.1 Gene:CARS1 / 833 HGNCID:1493 Length:867 Species:Homo sapiens
Sequence 2:NP_001286506.1 Gene:eEF1beta / 45249 FlyBaseID:FBgn0028737 Length:222 Species:Drosophila melanogaster


Alignment Length:221 Identity:55/221 - (24%)
Similarity:85/221 - (38%) Gaps:84/221 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    28 LNEHLSTRSYVQGYSLSQADVDAFRQL-SAPPADPQLFHVARWFRHIEALLGSPCGKGQPCRLQA 91
            ||..|:..||:.||:.|:||:..|..| .||.||.  .:||||:|||                 |
  Fly    15 LNAFLADNSYISGYTPSKADLSVFDALGKAPSADN--VNVARWYRHI-----------------A 60

Human    92 SKGRRVQPQWSPPAGTQPCRLHLYNSLTRNKEVFIPQ--DGKKVTWYCCGPTVYDASHMGHARSY 154
            |.....:..||   ||.                 :||  .||        |||..|:        
  Fly    61 SFEAAERAAWS---GTP-----------------LPQLAGGK--------PTVAAAA-------- 89

Human   155 ISFDILRRVLKDYFKFDVFYCMNITDIDDKIIKRARQNHL--FEQYREKRP----EAAQLLEDVQ 213
                  :....|....|:|   ...|.:|:..:|.:|..:  :...:.|:|    :::.||:   
  Fly    90 ------KPAADDDDDVDLF---GSDDEEDEEAERIKQERVAAYAAKKSKKPALIAKSSVLLD--- 142

Human   214 AALKPFSVKLNETTDPDKKQMLERIQ 239
              :||:.   :||   |.|:|...::
  Fly   143 --VKPWD---DET---DMKEMENNVR 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARS1XP_024304469.1 GST_C_CysRS_N 3..76 CDD:198343 23/48 (48%)
PTZ00399 91..858 CDD:240402 32/157 (20%)
eEF1betaNP_001286506.1 GST_C_eEF1b_like <3..62 CDD:198341 24/65 (37%)
EF1_GNE 139..222 CDD:279125 9/33 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.