DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARS1 and eEF1delta

DIOPT Version :9

Sequence 1:XP_024304469.1 Gene:CARS1 / 833 HGNCID:1493 Length:867 Species:Homo sapiens
Sequence 2:NP_609361.1 Gene:eEF1delta / 34363 FlyBaseID:FBgn0032198 Length:256 Species:Drosophila melanogaster


Alignment Length:166 Identity:36/166 - (21%)
Similarity:60/166 - (36%) Gaps:46/166 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   706 YLQVLSEFREGVRKIAREQKVPEILQLSDALRDNILPELGVRFEDHEGLPTVVKLVDR------- 763
            |..::||..:....|....:..:.:.|.|.|...:...|.....:|:.|.|.|.|::.       
  Fly    36 YSPLVSEIAKAREHIQNSLEKIDGVTLDDGLNSELAKRLAQLEGEHKELKTQVSLLNELLTATVK 100

Human   764 ---------NTLLKEREEKRRVEE-------------EKRKKKEEAARRKQEQEAAKLAKMK--- 803
                     |.:.||.|.:.:..|             :..::..||||.::|:.||..||..   
  Fly   101 RLETQLKLTNGVSKEPEVEAKKPEANDDDDDVDLFGSDSEEEDGEAARIREERLAAYAAKKAKKV 165

Human   804 --IPPSEMFL------SETD------KYSKFDENGL 825
              |..|.:.|      .|||      :..|..::||
  Fly   166 QIIAKSNIILDVKPWDDETDLKVMETEIRKITQDGL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARS1XP_024304469.1 GST_C_CysRS_N 3..76 CDD:198343
PTZ00399 91..858 CDD:240402 36/166 (22%)
eEF1deltaNP_609361.1 EF-1_beta_acid 134..>156 CDD:287546 5/21 (24%)
EF1B 168..256 CDD:238181 9/34 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.