DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HTA7 and His2A:CG33832

DIOPT Version :9

Sequence 1:NP_198119.1 Gene:HTA7 / 832829 AraportID:AT5G27670 Length:150 Species:Arabidopsis thaliana
Sequence 2:NP_001027331.1 Gene:His2A:CG33832 / 3772632 FlyBaseID:FBgn0053832 Length:124 Species:Drosophila melanogaster


Alignment Length:120 Identity:90/120 - (75%)
Similarity:99/120 - (82%) Gaps:3/120 - (2%)


- Green bases have known domain annotations that are detailed below.


plant    12 RGAGGRKGGDRKKSVSKSVKAGLQFPVGRIARYLKKGRYALRYGSGAPVYLAAVLEYLAAEVLEL 76
            ||.||:..|   |:.|:|.:||||||||||.|.|:||.||.|.|:|||||||||:||||||||||
  Fly     4 RGKGGKVKG---KAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLEL 65

plant    77 AGNAARDNKKNRINPRHLCLAIRNDEELGRLLHGVTIASGGVLPNINPVLLPKKS 131
            ||||||||||.||.||||.|||||||||.:||.|||||.|||||||..||||||:
  Fly    66 AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HTA7NP_198119.1 PTZ00017 12..140 CDD:185399 90/120 (75%)
His2A:CG33832NP_001027331.1 PTZ00017 16..124 CDD:185399 84/105 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23430
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.