DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FZD8 and fz

DIOPT Version :9

Sequence 1:NP_114072.1 Gene:FZD8 / 8325 HGNCID:4046 Length:694 Species:Homo sapiens
Sequence 2:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster


Alignment Length:667 Identity:248/667 - (37%)
Similarity:340/667 - (50%) Gaps:118/667 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    11 SLLAALALLQRSSGAAAASAKEL-------ACQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLE 68
            |.|.|....:...|..|:|..||       .|:.||:.:||.|.||.|.|||...|..|:|||||
  Fly    22 SPLDASPYYRSGGGLMASSGTELDGLPHHNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLE 86

Human    69 VHQFWPLVEIQCSPDLKFFLCSMYTPIC--LEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPD 131
            ||||.|||:|.||.||:.||||:|.|:|  ||   :|:|||||:||.|:. |..||:.|.|.||:
  Fly    87 VHQFAPLVKIGCSDDLQLFLCSLYVPVCTILE---RPIPPCRSLCESARV-CEKLMKTYNFNWPE 147

Human   132 RMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPGEQPPSGSGHGRPPGARPPHRGGG 196
            .:.|.:.|..|..| ||:..|.|...:.|.:|.|.:         ...:......|...|||..|
  Fly   148 NLECSKFPVHGGED-LCVAENTTSSASTAATPTRSV---------AKVTTRKHQTGVESPHRNIG 202

Human   197 RGGGGGDAAAPPARGGGGGGKARPPGGGAAPCEPGCQCRAPMVSVSSERHPLYNRVKTG--QIAN 259
                   ...|                        .|.:.|:        .:...:|.|  .:.:
  Fly   203 -------FVCP------------------------VQLKTPL--------GMGYELKVGGKDLHD 228

Human   260 CALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVS 324
            |..|||..||.:.||....:|:|.|:.:|..|...||.|||||..||:||||.|:||:.|||.|.
  Fly   229 CGAPCHAMFFPERERTVLRYWVGSWAAVCVASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVG 293

Human   325 VGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAAAGAGAAGAGAGGPGGRGEYEELGAVEQHVRYE 389
            ..|:..|.|| :.|:|....|                       .|...|..:.:..:.|..|..
  Fly   294 CAYVAGLGAG-DSVSCREPFP-----------------------PPVKLGRLQMMSTITQGHRQT 334

Human   390 TTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSI 454
            |:    |||:|:.:||..||:..||..|:..||||||:|||:|||...|..|||.||.||::::|
  Fly   335 TS----CTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENKSHLFHLVAWAVPALQTI 395

Human   455 AVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQDG 519
            :||||:.|:||.::|:|:||.....:|..|::.||.|||.||.:||||||:||||||:|:| .||
  Fly   396 SVLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGALFLLAGFISLFRIRTVMK-TDG 459

Human   520 PTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHN----------CPCLRDLQ 574
             .:|.|||:||:|:|.|:.|:.:||..::.|||||.:|...|....:          ||..|...
  Fly   460 -KRTDKLERLMLRIGFFSGLFILPAVGLLGCLFYEYYNFDEWMIQWHRDICKPFSIPCPAARAPG 523

Human   575 PDQARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRSLCTRCCWASKGAAVGGGAGATAAG 639
            ..:| ||.:.:||:||...::||:||.||::|.||:.|||:...|         :.|....|.|.
  Fly   524 SPEA-RPIFQIFMVKYLCSMLVGVTSSVWLYSSKTMVSWRNFVER---------LQGKEPRTRAQ 578

Human   640 G----GGGPGGGGGGGP 652
            .    ..||.||....|
  Fly   579 AYVXYETGPAGGAKSTP 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FZD8NP_114072.1 CRD_FZ8 31..155 CDD:143570 65/132 (49%)
Palmitate-binding groove. /evidence=ECO:0000250 71..78 5/6 (83%)
Wnt-binding. /evidence=ECO:0000250 95..100 3/6 (50%)
Wnt-binding. /evidence=ECO:0000250 147..152 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..226 9/70 (13%)
7tmF_FZD8 267..618 CDD:320378 150/360 (42%)
TM helix 1 277..301 CDD:320378 9/23 (39%)
TM helix 2 310..331 CDD:320378 10/20 (50%)
TM helix 3 397..419 CDD:320378 10/21 (48%)
TM helix 4 440..456 CDD:320378 8/15 (53%)
TM helix 5 478..501 CDD:320378 10/22 (45%)
TM helix 6 534..556 CDD:320378 10/21 (48%)
TM helix 7 579..604 CDD:320378 11/24 (46%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 608..613 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 648..668 1/5 (20%)
PDZ-binding 692..694
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 62/120 (52%)
Frizzled 237..564 CDD:279827 150/357 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X126
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.