Sequence 1: | NP_114072.1 | Gene: | FZD8 / 8325 | HGNCID: | 4046 | Length: | 694 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_610297.2 | Gene: | Corin / 35691 | FlyBaseID: | FBgn0033192 | Length: | 1397 | Species: | Drosophila melanogaster |
Alignment Length: | 183 | Identity: | 47/183 - (25%) |
---|---|---|---|
Similarity: | 76/183 - (41%) | Gaps: | 33/183 - (18%) |
- Green bases have known domain annotations that are detailed below.
Human 12 LLAALALLQRSSGAAA-------------------------ASAKELA---CQEITVPLCKG--I 46
Human 47 GYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVC 111
Human 112 ERAKAGCAPLMRQYGFAWPDRMRCDRLPE-QGNPDTLCMDYNRTDLTTAAPSP 163 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |