DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FZD8 and Corin

DIOPT Version :9

Sequence 1:NP_114072.1 Gene:FZD8 / 8325 HGNCID:4046 Length:694 Species:Homo sapiens
Sequence 2:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster


Alignment Length:183 Identity:47/183 - (25%)
Similarity:76/183 - (41%) Gaps:33/183 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    12 LLAALALLQRSSGAAA-------------------------ASAKELA---CQEITVPLCKG--I 46
            |:.|.|||..:.|.||                         :..|..|   |..|.|..|:|  |
  Fly   728 LINAFALLAIAGGLAAYFNAYPTIKFVNKTIINTIHVEDTTSFGKNPAPGTCLPIIVRFCQGPQI 792

Human    47 GYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVC 111
            .||||..||...|..|.|...::..:..||:::|...:..|||:::.|.|.:. ...:|||:::|
  Fly   793 PYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLFVPKCGQS-GATVPPCKTLC 856

Human   112 ERAKAGCAPLMRQYGFAWPDRMRCDRLPE-QGNPDTLCMDYNRTDLTTAAPSP 163
            ......|......:|.:.|:.:.|....: ..:.|.:.:|..| ::..||..|
  Fly   857 TETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSEDCVGLDEVR-EVMRAATHP 908

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FZD8NP_114072.1 CRD_FZ8 31..155 CDD:143570 36/129 (28%)
Palmitate-binding groove. /evidence=ECO:0000250 71..78 2/6 (33%)
Wnt-binding. /evidence=ECO:0000250 95..100 1/4 (25%)
Wnt-binding. /evidence=ECO:0000250 147..152 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..226 3/9 (33%)
7tmF_FZD8 267..618 CDD:320378
TM helix 1 277..301 CDD:320378
TM helix 2 310..331 CDD:320378
TM helix 3 397..419 CDD:320378
TM helix 4 440..456 CDD:320378
TM helix 5 478..501 CDD:320378
TM helix 6 534..556 CDD:320378
TM helix 7 579..604 CDD:320378
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 608..613
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 648..668
PDZ-binding 692..694
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 32/116 (28%)
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.