DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F8H and sotv

DIOPT Version :9

Sequence 1:NP_001330046.1 Gene:F8H / 832358 AraportID:AT5G22940 Length:498 Species:Arabidopsis thaliana
Sequence 2:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster


Alignment Length:370 Identity:82/370 - (22%)
Similarity:137/370 - (37%) Gaps:69/370 - (18%)


- Green bases have known domain annotations that are detailed below.


plant   138 MKIYVYDLPASYNDDWVTASDRCASHLFAAEVAIHRALLSSDVRTLDPDEADYFFVPVYVSCNFS 202
            :|:|:|.|....::.    ||:.|:.|.:....|..|:|.|...|.:|:|| ..|:|   |.:..
  Fly   108 LKVYIYPLQEFVDEQ----SDKTATTLSSEYFQILEAVLKSRYYTSNPNEA-CLFLP---SLDLL 164

plant   203 TSNGFPSLSHARSLLSSAVDFLSDHYPFWNRSQGSDHVFVASHDFGA-CFHAMEDMAIEEGIPKF 266
            ..|.|.  .|......:::|       ||:|  |::|:.......|| .::.:.|:..:..|   
  Fly   165 NQNVFD--KHLAGAALASLD-------FWDR--GANHIIFNMLPGGAPSYNTVLDVNTDNAI--- 215

plant   267 MKRSIILQTFGVKYKHPCQEVEHVVIPPYIPPESVQKAIEKAPVNGRRDIWAFFRGKMEVNPKNI 331
                    .||..:..........|..|...|..|:   :.|....:|      :..:.|...||
  Fly   216 --------IFGGGFDSWSYRPGFDVAIPVWSPRLVR---QHAHATAQR------KFLLVVAQLNI 263

plant   332 SGRFYSKGVRTAILKKFGGRRRFYL----------------NRHRFAGYRSEIVRSVFCLCPLGW 380
            ..||    |||..........:..|                ..|:...|...:.|..|||.....
  Fly   264 LPRF----VRTLRELSLAHSEQLLLLGACENLDLTMRCPLSQHHKSLEYPRLLSRGKFCLLGRSL 324

plant   381 APWSPRLVESAVLGCVPVVIADGIQLPFSETVQWPEISLTVAEKDVRNLRKVLEHVAATNLSAIQ 445
            ....|.|||.....|:||:..|...|||.:.:.|...|:.:.|.::.::.:.|:.:::..:..:|
  Fly   325 RMGQPDLVEIMSQHCIPVIAVDNYVLPFEDVIDWSLASVRIRENELHSVMQKLKAISSVKIVEMQ 389

plant   446 RN---LHEPVFKRALLYNVPMKEGDATWHILESLWRKLDDRSYRR 487
            :.   |....||......:...|      :|||....|..||.|:
  Fly   390 KQVQWLFSKYFKDLKTVTLTALE------VLESRIFPLRARSSRQ 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F8HNP_001330046.1 None
sotvNP_725536.1 Exostosin 105..380 CDD:281069 70/314 (22%)
Glyco_transf_64 455..689 CDD:286358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.