DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HTB2 and His2B:CG33868

DIOPT Version :9

Sequence 1:NP_197679.1 Gene:HTB2 / 832352 AraportID:AT5G22880 Length:145 Species:Arabidopsis thaliana
Sequence 2:NP_001027385.1 Gene:His2B:CG33868 / 3772265 FlyBaseID:FBgn0053868 Length:123 Species:Drosophila melanogaster


Alignment Length:128 Identity:89/128 - (69%)
Similarity:102/128 - (79%) Gaps:7/128 - (5%)


- Green bases have known domain annotations that are detailed below.


plant    18 PAAEPAAAAEKKPKAGKKLPKEPAGAGDKKKKRSKKNVETYKIYIFKVLKQVHPDIGISSKAMGI 82
            |......||:|..||.|.:.|.     ||||||.:|  |:|.|||:|||||||||.|||||||.|
  Fly     2 PPKTSGKAAKKAGKAQKNITKT-----DKKKKRKRK--ESYAIYIYKVLKQVHPDTGISSKAMSI 59

plant    83 MNSFINDIFEKLAGESSKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 145
            ||||:|||||::|.|:|:||.|||:.|||||||||||||:|||||||||||||||||||:|||
  Fly    60 MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HTB2NP_197679.1 H2B 54..144 CDD:197718 71/89 (80%)
His2B:CG33868NP_001027385.1 H2B 33..121 CDD:197718 71/87 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1804
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I1530
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm2531
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X77
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.