Sequence 1: | NP_001158087.1 | Gene: | FZD6 / 8323 | HGNCID: | 4044 | Length: | 706 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_610297.2 | Gene: | Corin / 35691 | FlyBaseID: | FBgn0033192 | Length: | 1397 | Species: | Drosophila melanogaster |
Alignment Length: | 195 | Identity: | 56/195 - (28%) |
---|---|---|---|
Similarity: | 80/195 - (41%) | Gaps: | 28/195 - (14%) |
- Green bases have known domain annotations that are detailed below.
Human 23 TCEPITVPRCM--KMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTC 85
Human 86 IEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKT 150
Human 151 EQVQRDIGFWCPRHLKTSGGQGYKFLGIDQ--CAPP---CPNMYFKSDELEFAK-SFIGTVSIFC 209
Human 210 209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FZD6 | NP_001158087.1 | CRD_FZ6 | 20..146 | CDD:143559 | 39/124 (31%) |
Frizzled | 189..507 | CDD:279827 | 6/22 (27%) | ||
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 | 498..503 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 588..706 | ||||
Corin | NP_610297.2 | CRD_FZ | 778..894 | CDD:143549 | 39/123 (32%) |
LDLa | 911..942 | CDD:238060 | 9/36 (25%) | ||
LDLa | 945..979 | CDD:238060 | 3/8 (38%) | ||
SR | 980..>1034 | CDD:214555 | |||
SRCR | 992..1086 | CDD:278931 | |||
Tryp_SPc | 1103..1343 | CDD:214473 | |||
Tryp_SPc | 1104..1346 | CDD:238113 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |