DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FZD4 and fz4

DIOPT Version :9

Sequence 1:NP_036325.2 Gene:FZD4 / 8322 HGNCID:4042 Length:537 Species:Homo sapiens
Sequence 2:NP_511068.2 Gene:fz4 / 31659 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster


Alignment Length:550 Identity:189/550 - (34%)
Similarity:279/550 - (50%) Gaps:93/550 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    43 RRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCT 107
            |:|:.|||.||:.:|||.|.||||||:|:|||.|..|.||.|||:|.|||||:.|||:.||||||
  Fly    44 RQCETIRIEMCRKIGYNETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCT 108

Human   108 EKINI-PIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVP--- 168
            .|..: .||||..:|.||:.||.|||:.|||.||.:|:|.|||.:|:|..|||||||:...|   
  Fly   109 PKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFPRENNHETMCMEGPGELHQPQQE 173

Human   169 --------------LPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFT 219
                          |..|.|:    :|..: ..|..|:.:.||..|...|..|. |::.:.|...
  Fly   174 QDLYGLPGQGIPGGLGGKLPM----DCSGL-AKSHLYVRLPRSGRCAPLCEADI-LFTPAEKHLA 232

Human   220 DIWMAVWASLCF-ISTAFTVLTFLIDSSRFSYPE-----RPIIFLSMCYNIYSIAYIVRLTVGRE 278
            :||::.||.... ::...||.....|.||.:..:     .|:|:   |:|:.::.:.||..|||.
  Fly   233 EIWVSTWAYAALGLALVATVCLLASDGSRLASAKWSRLLSPLIW---CHNMVTLGWAVRFMVGRT 294

Human   279 RISCDFEEAA--EPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIE 341
            ..:|..:..|  |.:|..:||.|..||.:||:.|:||||:..||.:|.|.|         |..|.
  Fly   295 GTACGTDPQAPNESLLTVDGLSNASCASVFLMRYYFGMAACAWWAVLCLGW---------HRDIR 350

Human   342 MHS--SYFHI-------------------------------AAWAIPAVKTIVILIMRLVDADEL 373
            .||  |..|:                               .||.:||.:|..:::.|.||||||
  Fly   351 RHSPDSKGHVVIPSNFGGSPAKRNSAKTAQQDLTQNNFVCFVAWGLPAFQTSAVIVARFVDADEL 415

Human   374 TGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDGTKT--DKLERLMVK 436
            .|.|:||||:..||...|..|:|.|.:.|::.:.:|.:...:.:..|:.....:  .:|::|...
  Fly   416 LGACFVGNQSDKALQILVATPVFCYWIFGSMNLISGYLVHCRTKEILRNSNALSVQQQLQQLSAH 480

Human   437 ----IGVFSVLYTVPATCVIACYFYEISNWALFRYSAD-DSNMAVEMLKIFMSLLVGITSGMWIW 496
                ||:|..:|.:....::....||.:|..::..|.| ::.:...:|:.||.|::||....|:.
  Fly   481 SSSGIGIFLFIYGLACAMLLLAVIYEFANIDVWLGSGDTNTPLWPFLLRAFMELMLGICCFAWVL 545

Human   497 --SAKTLHTWQKCSNRLVNSGK-VKREKRG 523
              |..||:      .|.|::|| ||....|
  Fly   546 GPSISTLY------KRQVSNGKMVKHTSAG 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FZD4NP_036325.2 CRD_FZ4 42..167 CDD:143557 75/124 (60%)
7tmF_FZD4 209..509 CDD:320166 95/349 (27%)
TM helix 1 218..243 CDD:320166 6/25 (24%)
TM helix 2 252..273 CDD:320166 5/25 (20%)
TM helix 3 303..329 CDD:320166 13/25 (52%)
TM helix 4 346..362 CDD:320166 6/46 (13%)
TM helix 5 384..413 CDD:320166 8/28 (29%)
TM helix 6 433..460 CDD:320166 7/30 (23%)
TM helix 7 470..495 CDD:320166 7/25 (28%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 499..504 2/4 (50%)
PDZ-binding 535..537
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 75/124 (60%)
7tm_4 223..544 CDD:304433 91/332 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160288
Domainoid 1 1.000 148 1.000 Domainoid score I4504
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D237456at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109675
Panther 1 1.100 - - LDO PTHR11309
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.