Sequence 1: | NP_003496.1 | Gene: | FZD1 / 8321 | HGNCID: | 4038 | Length: | 647 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_610297.2 | Gene: | Corin / 35691 | FlyBaseID: | FBgn0033192 | Length: | 1397 | Species: | Drosophila melanogaster |
Alignment Length: | 211 | Identity: | 56/211 - (26%) |
---|---|---|---|
Similarity: | 83/211 - (39%) | Gaps: | 48/211 - (22%) |
- Green bases have known domain annotations that are detailed below.
Human 111 PDHGYCQPISIPLC--TDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMY 173
Human 174 APVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTP 238
Human 239 TPSLLPEF-----WTSNPQHGGGGHRGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDC-- 296
Human 297 ---GAPCE---PTKVY 306 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FZD1 | NP_003496.1 | CRD_FZ1 | 112..238 | CDD:143574 | 39/127 (31%) |
Frizzled | 310..634 | CDD:279827 | |||
Corin | NP_610297.2 | CRD_FZ | 778..894 | CDD:143549 | 36/115 (31%) |
LDLa | 911..942 | CDD:238060 | 9/50 (18%) | ||
LDLa | 945..979 | CDD:238060 | 2/7 (29%) | ||
SR | 980..>1034 | CDD:214555 | |||
SRCR | 992..1086 | CDD:278931 | |||
Tryp_SPc | 1103..1343 | CDD:214473 | |||
Tryp_SPc | 1104..1346 | CDD:238113 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |