DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT5G19670 and sotv

DIOPT Version :9

Sequence 1:NP_001332525.1 Gene:AT5G19670 / 832087 AraportID:AT5G19670 Length:610 Species:Arabidopsis thaliana
Sequence 2:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster


Alignment Length:386 Identity:82/386 - (21%)
Similarity:138/386 - (35%) Gaps:125/386 - (32%)


- Green bases have known domain annotations that are detailed below.


plant   281 LKVYVYKEGNRPIFHTPILKGL----------YASEGWFMKLMEG--NKQYTVKDPRKAHLYYMP 333
            ||||:|          |:.:.:          .:||  :.:::|.  ..:|...:|.:|.| ::|
  Fly   108 LKVYIY----------PLQEFVDEQSDKTATTLSSE--YFQILEAVLKSRYYTSNPNEACL-FLP 159

plant   334 FSARMLEYTLYVRNSHNRTNLRQFLKEYTEHISSKYPFFNRTDGADH------------------ 380
                          |.:..|...|.|.......:...|::|  ||:|                  
  Fly   160 --------------SLDLLNQNVFDKHLAGAALASLDFWDR--GANHIIFNMLPGGAPSYNTVLD 208

plant   381 ---------------------FLVACHDWAPYETRHHMEHCIKALCNADVTAGFK---IGRDISL 421
                                 |.||...|:|...|.|          |..||..|   :...:::
  Fly   209 VNTDNAIIFGGGFDSWSYRPGFDVAIPVWSPRLVRQH----------AHATAQRKFLLVVAQLNI 263

plant   422 PETYVRAAKNPLRDLGGKPPSQRRTLAFYAGSMHGYLRQILLQHWKDKDPDMKIFGRMPFGVASK 486
            ...:||.    ||:| ....|::..|.....::...:|..|.||.|                  .
  Fly   264 LPRFVRT----LREL-SLAHSEQLLLLGACENLDLTMRCPLSQHHK------------------S 305

plant   487 MNYIEQMKSSKYCICPKGYEVNSPRVVESIFYECVPVIISDNFVPPFFEVLDWSAFSVIVAEKDI 551
            :.|...:...|:|:..:...:..|.:||.:...|:|||..||:|.||.:|:|||..||.:.|.::
  Fly   306 LEYPRLLSRGKFCLLGRSLRMGQPDLVEIMSQHCIPVIAVDNYVLPFEDVIDWSLASVRIRENEL 370

plant   552 PRLKDILLSIPEDKYVKMQMAVRKAQRHFLWHAKPEKYDLFHMVLHS--IWYNRVFQAKRR 610
            ..:...|.:|...|.|:||..|:       |.......||..:.|.:  :..:|:|..:.|
  Fly   371 HSVMQKLKAISSVKIVEMQKQVQ-------WLFSKYFKDLKTVTLTALEVLESRIFPLRAR 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT5G19670NP_001332525.1 Exostosin 281..561 CDD:367297 69/333 (21%)
sotvNP_725536.1 Exostosin 105..380 CDD:281069 69/333 (21%)
Glyco_transf_64 455..689 CDD:286358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.