DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MPK16 and rl

DIOPT Version :9

Sequence 1:NP_197402.1 Gene:MPK16 / 832019 AraportID:AT5G19010 Length:567 Species:Arabidopsis thaliana
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:355 Identity:165/355 - (46%)
Similarity:234/355 - (65%) Gaps:11/355 - (3%)


- Green bases have known domain annotations that are detailed below.


plant     8 KSSVEVDFFTEYGEGSRYRIEEVIGKGSYGVVCSAYDTHTGEKVAIKKINDIFEHVSDATRILRE 72
            :|:.||.....:..|.||.....||:|:||:|.||.||.|.::||||||:. |||.:...|.|||
  Fly    21 QSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKISP-FEHQTYCQRTLRE 84

plant    73 IKLLRLLRHPDIVEIKHILLPPSRREFRDIYVVFELMESDLHQVIKANDDLTPEHYQFFLYQLLR 137
            |.:|...:|.:|::|:.||...|..:.||:|:|..|||:||::::| ...|:.:|..:||||:||
  Fly    85 ITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLK-TQRLSNDHICYFLYQILR 148

plant   138 GLKYIHTANVFHRDLKPKNILANADCKLKICDFGLARVAFNDTPTAIFWTDYVATRWYRAPELCG 202
            ||||||:|||.||||||.|:|.|..|.||||||||||:|..:.....|.|:|||||||||||:  
  Fly   149 GLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEI-- 211

plant   203 SFFSK-YTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMTDMLGTPSAEAIGRVRNEKARRY 266
            ...|| ||.:|||||:|||.||:|:.:|:||||:.:.||:.:..:||:||.:.:..:.|||||.|
  Fly   212 MLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNY 276

plant   267 LSSMRKKKPIPFSHKFPHTDPLALRLLEKMLSFEPKDRPTAEEALADVYFKGLAKVEREPSAQPV 331
            |.|:..|..:|::..||:.|.|||.||.|||:|.|..|...|||||..|.:..    .:|..:||
  Fly   277 LESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQY----YDPGDEPV 337

plant   332 TKLEF--EFERRRITKEDVRELIYRESLEY 359
            .::.|  ..|...|:::.::.||:.|:|::
  Fly   338 AEVPFRINMENDDISRDALKSLIFEETLKF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MPK16NP_197402.1 STKc_TDY_MAPK 24..361 CDD:143364 161/339 (47%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 161/341 (47%)
S_TKc 38..326 CDD:214567 149/291 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.