DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EOMES and Doc2

DIOPT Version :9

Sequence 1:NP_001265111.1 Gene:EOMES / 8320 HGNCID:3372 Length:705 Species:Homo sapiens
Sequence 2:NP_648282.1 Gene:Doc2 / 39038 FlyBaseID:FBgn0035956 Length:469 Species:Drosophila melanogaster


Alignment Length:448 Identity:147/448 - (32%)
Similarity:205/448 - (45%) Gaps:105/448 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   260 VPGSGFRAHVYLCNRPLWLKFHRHQTEMIITKQGRRMFPFLSFNINGLNPTAHYNVFVEVVLADP 324
            :||    ..:.|.|..||.:||:..|||||||.||||||.:..:::||...::|.|.:|:|....
  Fly    53 LPG----VEMTLQNDDLWKQFHQIGTEMIITKSGRRMFPSMRLSVSGLEDESNYCVLLEMVPIGD 113

Human   325 NHWRFQGGKWVTCGKADNNMQGNKMYVHPESPNTGSHWMRQEISFGKLKLTNNKGANNNNTQMIV 389
            ..::|.|.:||..|.|: .....:||:||:||.||:||..|.|.|.|:|||||   ..:|:..||
  Fly   114 CRYKFSGSQWVPAGGAE-PQSPQRMYLHPDSPATGAHWQAQPILFNKVKLTNN---TLDNSGHIV 174

Human   390 LQSLHKYQPRLHIVEVTEDGVEDLNE-P-SKTQTFTFSETQFIAVTAYQNTDITQLKIDHNPFAK 452
            |.|:||||||||::...     ||.: | :..|.|.|:||:|:|||||||..||:||||:|||||
  Fly   175 LASMHKYQPRLHVIRTA-----DLAQIPWAPQQAFVFAETEFVAVTAYQNDRITKLKIDNNPFAK 234

Human   453 GFRD--------NYDSMYTASENDR---LTPSPTDSPRSHQIVPGG---RYGVQSFFPE--PFVN 501
            |||:        ...|..|..:.|:   |:.|.:.|........||   ..|..|....  |.:.
  Fly   235 GFRETGQSRCKRKMSSSPTGEDQDQSPSLSHSQSQSESDMSPTKGGGETAGGTSSIGDSDGPQIK 299

Human   502 TLPQARYYNG----------ERTVPQTNGLL--SPQQSEEVANPPQRWLVTPVQQPGTNKLDISS 554
            .|..    ||          :::||..:.|.  ||.......:.|.     |:|....:.:.:..
  Fly   300 RLRS----NGSACSLSSSLDDQSVPGASSLALGSPPPHLHSHSHPH-----PLQARSASSVFMQH 355

Human   555 YESEYTSSTLLP---------------YG--IKSLPLQTSHALGYYPDPTFPAMAGWGGRGSYQR 602
            :: :...|.|.|               ||  |::.|:        ||    ||.....|.|.:. 
  Fly   356 FQ-QNMQSLLRPSLVDLACTYFGRPHEYGGAIQASPM--------YP----PAAMLQAGLGPHP- 406

Human   603 KMAAGLPWTSRTSPTVFSEDQLSKEKVKEE----IGS-------SWIETP---PSIKS 646
              ...||      |.|...|.:|.|...||    :||       |..|.|   ||.:|
  Fly   407 --GLNLP------PGVSGADLISDESGAEELELDVGSETSTLEQSTQEQPLEQPSTRS 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EOMESNP_001265111.1 TBOX 267..460 CDD:238106 93/202 (46%)
T-box_assoc 482..703 CDD:292794 46/213 (22%)
Doc2NP_648282.1 TBOX 55..242 CDD:238106 94/199 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11267
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.