DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EOMES and bi

DIOPT Version :9

Sequence 1:NP_001265111.1 Gene:EOMES / 8320 HGNCID:3372 Length:705 Species:Homo sapiens
Sequence 2:NP_001259238.1 Gene:bi / 31379 FlyBaseID:FBgn0000179 Length:1023 Species:Drosophila melanogaster


Alignment Length:643 Identity:185/643 - (28%)
Similarity:248/643 - (38%) Gaps:209/643 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    65 SGEPAAASAGAPAAMLSDTDAGDAFA--SAAAVAKPGPPDGRKGSPCGEEELPSAAAAAAAAAAA 127
            :|.|.....|.|.....:.::..:.:  ||:|.|.|      ...|......||..|||..|.|.
  Fly   159 AGTPPPTIVGLPPIPPPNNNSSSSSSNNSASAAAHP------SHHPTAAHHSPSTGAAAPPAGAT 217

Human   128 AAATARYSMDSLSSERYYLQSPGPQGSELAAPCSLFPYQAAAGAPH-------GPVYPAPNGARY 185
            .                 |..|.|                    ||       ...:|||.    
  Fly   218 G-----------------LPPPTP--------------------PHHLQQQQQQQQHPAPP---- 241

Human   186 PYGSMLPPGGFPAAVCPPGRAQFGPGAGAGSGAGGSSG---GGGGPGTYQYSQGAPLYGPYPGAA 247
                  ||..||||..         .|.|||.||...|   |||    .::....|  |.:|.|.
  Fly   242 ------PPPYFPAAAL---------AALAGSPAGPHPGLYPGGG----LRFPPHHP--GAHPHAH 285

Human   248 AAGSCGGLGGLGVPGSGFRAHVYLCNRP-----------------------LWLKFHRHQTEMII 289
            ..||........|..|.....::...||                       ||.|||:..|||:|
  Fly   286 HLGSAYTTAEDVVLASAVAHQLHPAMRPLRALQPEDDGVVDDPKVTLEGKDLWEKFHKLGTEMVI 350

Human   290 TKQGRRMFPFLSFNINGLNPTAHYNVFVEVVLADPNHWRFQGGKWVTCGKADNNMQGNKMYVHPE 354
            ||.||:|||.:.|.::||:..|.|.:.:::|.||...::|...:|:..||||..|. .:||:||:
  Fly   351 TKSGRQMFPQMKFRVSGLDAKAKYILLLDIVAADDYRYKFHNSRWMVAGKADPEMP-KRMYIHPD 414

Human   355 SPNTGSHWMRQEISFGKLKLTNNKGANNNNTQMIVLQSLHKYQPRLHIVEVTEDGVEDLNEPSKT 419
            ||.||..||::.:||.|||||||....:......:|.|:||||||.|:|...    :.|..|..|
  Fly   415 SPTTGEQWMQKVVSFHKLKLTNNISDKHGFVSTTILNSMHKYQPRFHLVRAN----DILKLPYST 475

Human   420 -QTFTFSETQFIAVTAYQNTDITQLKIDHNPFAKGFRD-------NYDSMYT--ASENDRLTPSP 474
             :|:.|.||:|||||||||..|||||||:|||||||||       ...::.:  .|::|:|.|:.
  Fly   476 FRTYVFKETEFIAVTAYQNEKITQLKIDNNPFAKGFRDTGAGKREKKQALMSNRGSDSDKLNPTH 540

Human   475 TDSPRSH-QIVPGGRYGVQSFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSE-----EVANP 533
            ..|.|:. .:...||        .|.::  |.|             .||..||.:     :|..|
  Fly   541 VSSSRAPLHLGHAGR--------PPHLH--PHA-------------ALLDNQQDDDDKLLDVVGP 582

Human   534 PQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTFPAMAGW---- 594
            ||                          |.|||.   |..||..||..:     ..|:|.|    
  Fly   583 PQ--------------------------SPLLPL---SHSLQQMHAHQH-----SAALAAWFNHL 613

Human   595 --GGRGSYQRKMAAGLPWTSRTSPTVFSEDQL--------------SKEKVKEEIGSS 636
              .|.|:.:...||        :....:||.|              |.....|.:|.|
  Fly   614 AGAGAGASEHAAAA--------AANASAEDALRRRLQADADVERDGSDSSCSESVGGS 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EOMESNP_001265111.1 TBOX 267..460 CDD:238106 94/223 (42%)
T-box_assoc 482..703 CDD:292794 36/180 (20%)
biNP_001259238.1 Optomotor-blind <260..318 CDD:287988 15/63 (24%)
T-box 330..513 CDD:279278 90/187 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.