DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AXIN2 and rgs1

DIOPT Version :10

Sequence 1:NP_004646.3 Gene:AXIN2 / 8313 HGNCID:904 Length:843 Species:Homo sapiens
Sequence 2:NP_593029.1 Gene:rgs1 / 2541764 PomBaseID:SPAC22F3.12C Length:481 Species:Schizosaccharomyces pombe


Alignment Length:110 Identity:25/110 - (22%)
Similarity:40/110 - (36%) Gaps:22/110 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   725 NHSATVQTGATPFSNPSLAPEDHK-----EPKKLAGVHALQASE--LVVTYFFCGEEIPYRRMLK 782
            ||||.|....:.||:.....:|..     ..:.|..||.:..|:  |:|..:......|      
pombe   183 NHSAPVIVSISRFSSTDQILKDSSFCEMLLVRMLGSVHEIGKSKNPLLVPVYSVSSPSP------ 241

Human   783 AQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETV 827
                     |:.|||...|:.:....::...|..:..:..|.|||
pombe   242 ---------KDSLSKVTKYQMFGIDIAEWLMCNTMLLDWSEMETV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AXIN2NP_004646.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75
AXIN1_TNKS_BD 10..75 CDD:465215
Tankyrase-binding motif 21..30
RGS_Axin 82..198 CDD:188662
Interaction with GSK3B. /evidence=ECO:0000250 327..413
Interaction with SIAH1 and SIAH2. /evidence=ECO:0000269|PubMed:28546513 334..393
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 396..435
Interaction with beta-catenin. /evidence=ECO:0000250 413..476
Axin_b-cat_bind 433..468 CDD:462616
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 447..494
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 561..674
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 718..748 8/22 (36%)
DAX 761..843 CDD:197474 14/69 (20%)
rgs1NP_593029.1 DEP 59..156 CDD:214489
DEP_RGS7-like 224..309 CDD:239897 14/69 (20%)
RGS_FLBA 344..480 CDD:188663
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.