DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT5G11130 and sotv

DIOPT Version :9

Sequence 1:NP_196674.2 Gene:AT5G11130 / 830981 AraportID:AT5G11130 Length:480 Species:Arabidopsis thaliana
Sequence 2:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster


Alignment Length:333 Identity:71/333 - (21%)
Similarity:125/333 - (37%) Gaps:113/333 - (33%)


- Green bases have known domain annotations that are detailed below.


plant   170 IYAIEGQFMDEIENG-----------------NSRFKAASPEEATVFYIPVGIVNIIRFVYRPYT 217
            ||.:: :|:||..:.                 .||:..::|.||.:|...:.::|          
  Fly   112 IYPLQ-EFVDEQSDKTATTLSSEYFQILEAVLKSRYYTSNPNEACLFLPSLDLLN---------- 165

plant   218 SYARDRLQNIVKDYI---SLISNRYPYWNRSRGADHFFLSC------------------------ 255
                   ||:...::   :|.|  ..:|:  |||:|...:.                        
  Fly   166 -------QNVFDKHLAGAALAS--LDFWD--RGANHIIFNMLPGGAPSYNTVLDVNTDNAIIFGG 219

plant   256 --HDWA--PDVSAVDPELYKHFIRALCNANSSEGF---------TPMRDVSLPEINIPHSQ---- 303
              ..|:  |......|......:|...:|.:...|         .|....:|.|:::.||:    
  Fly   220 GFDSWSYRPGFDVAIPVWSPRLVRQHAHATAQRKFLLVVAQLNILPRFVRTLRELSLAHSEQLLL 284

plant   304 LGFVHTGEPPQNRKLLAFFAGGSHGDVRKILFQHWKEKDKDVLVYENLPKTMNYTKMMDKAKFCL 368
            ||..      :|..|          .:|..|.||              .|::.|.:::.:.||||
  Fly   285 LGAC------ENLDL----------TMRCPLSQH--------------HKSLEYPRLLSRGKFCL 319

plant   369 CPSGWEVASPRIVESLYSGCVPVIIADYYVLPFSDVLNWKTFSVHIPISKMPDIKKILEAITEEE 433
            ......:..|.:||.:...|:|||..|.|||||.||::|...||.|..:::..:.:.|:||:..:
  Fly   320 LGRSLRMGQPDLVEIMSQHCIPVIAVDNYVLPFEDVIDWSLASVRIRENELHSVMQKLKAISSVK 384

plant   434 YLNMQRRV 441
            .:.||::|
  Fly   385 IVEMQKQV 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT5G11130NP_196674.2 Exostosin 145..429 CDD:367297 66/319 (21%)
sotvNP_725536.1 Exostosin 105..380 CDD:281069 66/319 (21%)
Glyco_transf_64 455..689 CDD:286358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.