DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP712A2 and Cyp12d1-d

DIOPT Version :9

Sequence 1:NP_680150.1 Gene:CYP712A2 / 830581 AraportID:AT5G06905 Length:521 Species:Arabidopsis thaliana
Sequence 2:NP_995812.1 Gene:Cyp12d1-d / 2768720 FlyBaseID:FBgn0053503 Length:521 Species:Drosophila melanogaster


Alignment Length:439 Identity:105/439 - (23%)
Similarity:186/439 - (42%) Gaps:117/439 - (26%)


- Green bases have known domain annotations that are detailed below.


plant    71 GSLRVLVVSDSDTAKLILKTHDPDFASKFVFGPRQFNVYK------GSEFFNAPYGSYWRFMKKL 129
            |.::.||.|.::....:....:|.|..     ||...:|.      .:||               
  Fly   135 GEVQGLVASQNEAWGKLRSAINPIFMQ-----PRGLRMYYEPLSNINNEF--------------- 179

plant   130 CMTKLFAGYQLDRFVDIREEETLAL-------LSTLVERSRNGEACDLGLEFTALTTKILSKMVM 187
                      ::|..:||:.:||.:       :|.||..|....|.|             .:|.:
  Fly   180 ----------IERIKEIRDPKTLEVPEDFTDEISRLVFESLGLVAFD-------------RQMGL 221

plant   188 GKRCRQNSNIPKEIRKIVSDIMACATRFGFMELFGPLRDLDLFGNGKKLRSSIWRY--------- 243
            .::.|.||:.                    :.||...||:........::.|:|:.         
  Fly   222 IRKNRDNSDA--------------------LTLFQTSRDIFRLTFKLDIQPSMWKIISTPTYRKM 266

plant   244 -----DEL--VEKILKEYEN--DKSNEEEEK--DKDIVDILLDTYNDPKAELRLTMNQIKFFILE 297
                 |.|  .:|:|||.::  :|..:..||  ...:::.|::.  |||..:.::        |:
  Fly   267 KRTLNDSLNVSQKMLKENQDALEKRRQAGEKINSNSMLERLMEI--DPKVAVIMS--------LD 321

plant   298 LFMASLDTTSAALQWTMTELINHPDIFAKIRDEIKSVVGTTNRLIKESDLQKLPYLQAAIKETLR 362
            :..|.:|.|:..|...:..|..|||..||:|:|:.|::.|.:.|:.|.:::.:|||:|.||||||
  Fly   322 ILFAGVDATATLLSAVLLCLSKHPDKQAKLREELLSIMPTKDSLLNEENMKDMPYLRAVIKETLR 386

plant   363 LHPVGPLLRRESNTDMKINGYDVKSGTKIFINAYGIMRDPTTYKDPDKFMPERFLVVEQDTERKM 427
            .:|.|....|....|:.::||.|..||.:.:.:..:|::.|.|..||:|:|||:| .:.:|.:||
  Fly   387 YYPNGFGTMRTCQNDVILSGYRVPKGTTVLLGSNVLMKEATYYPRPDEFLPERWL-RDPETGKKM 450

plant   428 GYYQQYMLELKGQDVNYLAFGSGRRGCLGASHASLVLSLTIGSLVQCFN 476
                      :.....:|.||.|.|.|:|.....|.:..|:..|::.|:
  Fly   451 ----------QVSPFTFLPFGFGPRMCIGKRVVDLEMETTVAKLIRNFH 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP712A2NP_680150.1 p450 6..482 CDD:299894 105/439 (24%)
Cyp12d1-dNP_995812.1 p450 70..508 CDD:299894 105/439 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.