DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATL43 and ASR1

DIOPT Version :9

Sequence 1:NP_196200.3 Gene:ATL43 / 830466 AraportID:AT5G05810 Length:407 Species:Arabidopsis thaliana
Sequence 2:NP_015418.2 Gene:ASR1 / 856208 SGDID:S000006297 Length:288 Species:Saccharomyces cerevisiae


Alignment Length:46 Identity:17/46 - (36%)
Similarity:23/46 - (50%) Gaps:2/46 - (4%)


- Green bases have known domain annotations that are detailed below.


plant   145 ECAVCLARFEPTEVLRLLPKCKHAFHVECVDTW--LDAHSTCPLCR 188
            ||.:|||..:..|....|..|.|.||:.|:..|  ...:..||:||
Yeast     3 ECPICLADDQEGEQFGCLNVCGHKFHLNCIREWHKYSINLKCPICR 48

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATL43NP_196200.3 RING-H2_EL5_like 145..188 CDD:319375 15/44 (34%)
ASR1NP_015418.2 RING-H2 4..48 CDD:319362 14/43 (33%)
PHD 121..167 CDD:214584
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I3034
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.