DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATL43 and ASR1

DIOPT Version :10

Sequence 1:NP_196200.3 Gene:ATL43 / 830466 AraportID:AT5G05810 Length:407 Species:Arabidopsis thaliana
Sequence 2:NP_015418.2 Gene:ASR1 / 856208 SGDID:S000006297 Length:288 Species:Saccharomyces cerevisiae


Alignment Length:46 Identity:17/46 - (36%)
Similarity:23/46 - (50%) Gaps:2/46 - (4%)


- Green bases have known domain annotations that are detailed below.


plant   145 ECAVCLARFEPTEVLRLLPKCKHAFHVECVDTW--LDAHSTCPLCR 188
            ||.:|||..:..|....|..|.|.||:.|:..|  ...:..||:||
Yeast     3 ECPICLADDQEGEQFGCLNVCGHKFHLNCIREWHKYSINLKCPICR 48

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATL43NP_196200.3 RING-H2_EL5-like 145..188 CDD:438124 15/44 (34%)
ASR1NP_015418.2 RING-H2_ASR1 1..56 CDD:438482 17/46 (37%)
PHD 121..167 CDD:214584
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.