DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATL43 and HRD1

DIOPT Version :9

Sequence 1:NP_196200.3 Gene:ATL43 / 830466 AraportID:AT5G05810 Length:407 Species:Arabidopsis thaliana
Sequence 2:NP_014630.1 Gene:HRD1 / 854149 SGDID:S000005373 Length:551 Species:Saccharomyces cerevisiae


Alignment Length:232 Identity:45/232 - (19%)
Similarity:82/232 - (35%) Gaps:70/232 - (30%)


- Green bases have known domain annotations that are detailed below.


plant   116 RKNSGIDRSV----IESLPVFRFGALSGHKDGLECAVCLARF--EPTEVL--------RLLPKCK 166
            |.|..:|.::    :|.|      ..|.:.|.: |.:|:...  .|.:..        :.|| |.
Yeast   322 RNNKQLDDTLVTVTVEQL------QNSANDDNI-CIICMDELIHSPNQQTWKNKNKKPKRLP-CG 378

plant   167 HAFHVECVDTWLDAHSTCPLCRYRVDPED---ILLIGDCNSWFELQFSKDESNSVNNNPPGLT-- 226
            |..|:.|:..|::...|||:||..|..|.   :......||....|.:..:|..:..:..|..  
Yeast   379 HILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTTFTSNSDITTQTTVTDSTGIATDQQGFANE 443

plant   227 -------------RFIPVSRI------------------------SGRHSSAGERASRLNEIRTS 254
                         |.:|...|                        :| .:|.|...|....:.|:
Yeast   444 VDLLPTRTTSPDIRIVPTQNIDTLAMRTRSTSTPSPTWYTFPLHKTG-DNSVGSSRSAYEFLITN 507

plant   255 SSYKSNPMSFRRSLDSSLKVN----DAGEEKSESVAV 287
            |..|.|.:..:.::::. :||    |.||:.::.:.:
Yeast   508 SDEKENGIPVKLTIENH-EVNSLHGDGGEQIAKKIVI 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATL43NP_196200.3 RING-H2_EL5_like 145..188 CDD:319375 13/52 (25%)
HRD1NP_014630.1 HRD1 5..551 CDD:227568 45/232 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.