powered by:
Protein Alignment ATL43 and YBR062C
DIOPT Version :9
Sequence 1: | NP_196200.3 |
Gene: | ATL43 / 830466 |
AraportID: | AT5G05810 |
Length: | 407 |
Species: | Arabidopsis thaliana |
Sequence 2: | NP_009618.2 |
Gene: | YBR062C / 852354 |
SGDID: | S000000266 |
Length: | 180 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 77 |
Identity: | 25/77 - (32%) |
Similarity: | 37/77 - (48%) |
Gaps: | 5/77 - (6%) |
- Green bases have known domain annotations that are detailed below.
plant 117 KNSGIDRSVIESLPVFRFGALSGHKDGLECAVCLARFEPTE--VLRLLPKCKHAFHVECVDTWLD 179
|::|...:...|||......|....: |::|...:...| ::..||.|.|.|.:||:..||.
Yeast 83 KSAGCPDTFAASLPRINKKKLKATDN---CSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLS 144
plant 180 AHSTCPLCRYRV 191
..:||||||..|
Yeast 145 RSTTCPLCRDNV 156
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.