DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATL43 and IRC20

DIOPT Version :9

Sequence 1:NP_196200.3 Gene:ATL43 / 830466 AraportID:AT5G05810 Length:407 Species:Arabidopsis thaliana
Sequence 2:NP_013348.1 Gene:IRC20 / 850949 SGDID:S000004237 Length:1556 Species:Saccharomyces cerevisiae


Alignment Length:195 Identity:46/195 - (23%)
Similarity:74/195 - (37%) Gaps:48/195 - (24%)


- Green bases have known domain annotations that are detailed below.


plant   110 GGVVGGRKNSGIDRSVIESLPVFRFGALSGHKDG------LECAVCLARFEPTEVLRLLPKCKHA 168
            ||.:..:.|:      |||..:: ...||..||.      |.|::||...|...::    ||.|.
Yeast  1204 GGTLDAKINN------IESRLIY-LKNLSRLKDTLNDNQILSCSICLGEVEIGAII----KCGHY 1257

plant   169 FHVECVDTWLDAHSTCPLCRYRVDPEDILLIGDC------NSWFELQFSK-------------DE 214
            |...|:.|||.|||.||:|:           |.|      |..|:....|             |.
Yeast  1258 FCKSCILTWLRAHSKCPICK-----------GFCSISEVYNFKFKNSTEKREKEIQEPRREGADS 1311

plant   215 SNSVNNNPPGLTRFIPVSRISGRHSSAGERASRLNEIRTSSSYKSNPMSFRRSLDSSLKVNDAGE 279
            |...:|....::....|.::.|.......:.:.:::|....|:.:. :.|...|.|.|::....|
Yeast  1312 SQDNSNENSIISNMSEVEKLFGNKYEQFHQINEVHQIHIKESFGAK-IDFVIKLISYLRLKSEQE 1375

plant   280  279
            Yeast  1376  1375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATL43NP_196200.3 RING-H2_EL5_like 145..188 CDD:319375 17/42 (40%)
IRC20NP_013348.1 HepA 172..>568 CDD:223627
DEXQc_SHPRH 383..602 CDD:350828
RAD18 1234..>1327 CDD:227719 27/107 (25%)
RING-HC_RNF10 1239..1276 CDD:319450 17/40 (43%)
SF2_C_SNF 1356..1485 CDD:350180 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.