DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATL43 and rnf111

DIOPT Version :9

Sequence 1:NP_196200.3 Gene:ATL43 / 830466 AraportID:AT5G05810 Length:407 Species:Arabidopsis thaliana
Sequence 2:NP_001072805.1 Gene:rnf111 / 780266 XenbaseID:XB-GENE-854131 Length:954 Species:Xenopus tropicalis


Alignment Length:100 Identity:33/100 - (33%)
Similarity:42/100 - (42%) Gaps:21/100 - (21%)


- Green bases have known domain annotations that are detailed below.


plant   115 GRKNSGIDRSVIE-----------SLPVFRFGALSGHKDGLE---------CAVCLARFEPTEVL 159
            |..|.|..:..||           |...|....|...:||.|         |.:||:..|..|.:
 Frog   851 GNVNRGASQGTIERCTYPHKYEKVSTDWFSQRKLHSKQDGEEATEEDTEEKCTICLSILEEGEDV 915

plant   160 RLLPKCKHAFHVECVDTWLDAHSTCPLCRYRVDPE 194
            |.|| |.|.||..|||.||..:..||:||..:|.:
 Frog   916 RRLP-CMHLFHQVCVDQWLITNKKCPICRVDIDTQ 949

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATL43NP_196200.3 RING-H2_EL5_like 145..188 CDD:319375 20/51 (39%)
rnf111NP_001072805.1 RNF111_N 1..272 CDD:405891
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..175
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..276
SUMO interaction motif 1 (SIM). /evidence=ECO:0000250|UniProtKB:Q6ZNA4 280..284
SUMO interaction motif 2 (SIM). /evidence=ECO:0000250|UniProtKB:Q6ZNA4 305..311
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..346
SUMO interaction motif 3 (SIM). /evidence=ECO:0000250|UniProtKB:Q6ZNA4 360..364
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..452
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 485..509
Ubiquitin binding. /evidence=ECO:0000250|UniProtKB:Q6ZSG1 867..869 0/1 (0%)
RING-H2_RNF111_like 901..945 CDD:319388 21/44 (48%)
Ubiquitin binding. /evidence=ECO:0000250|UniProtKB:Q6ZSG1 917..921 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I4518
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.