powered by:
Protein Alignment ATL43 and Rnf215
DIOPT Version :9
Sequence 1: | NP_196200.3 |
Gene: | ATL43 / 830466 |
AraportID: | AT5G05810 |
Length: | 407 |
Species: | Arabidopsis thaliana |
Sequence 2: | NP_082135.2 |
Gene: | Rnf215 / 71673 |
MGIID: | 1918923 |
Length: | 379 |
Species: | Mus musculus |
Alignment Length: | 65 |
Identity: | 31/65 - (47%) |
Similarity: | 37/65 - (56%) |
Gaps: | 12/65 - (18%) |
- Green bases have known domain annotations that are detailed below.
plant 128 SLPVFRFGALSGHKDGLE-CAVCLARFEPTEVLRLLPKCKHAFHVECVDTWLDAHSTCPLCRYRV 191
||| :.|.| |||||..|...:.||:|| |||.||.:|||.||....|||||::.|
Mouse 318 SLP----------EPGTETCAVCLDYFCNKQWLRVLP-CKHEFHRDCVDPWLMLQQTCPLCKFNV 371
plant 192 191
Mouse 372 371
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
62 |
1.000 |
Domainoid score |
I4518 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.