DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATL43 and Rnf149

DIOPT Version :9

Sequence 1:NP_196200.3 Gene:ATL43 / 830466 AraportID:AT5G05810 Length:407 Species:Arabidopsis thaliana
Sequence 2:NP_001028307.2 Gene:Rnf149 / 67702 MGIID:2677438 Length:394 Species:Mus musculus


Alignment Length:228 Identity:64/228 - (28%)
Similarity:91/228 - (39%) Gaps:64/228 - (28%)


- Green bases have known domain annotations that are detailed below.


plant    58 IAVVIAVLT-AFFSLTFLLLLYVKHCKRRNGSVYVNHPQRFAITRYGGGYYNGGGVVGGRKNSGI 121
            :.|.||.:| ...||.:|:..|:               |||..|         |...|.:.:...
Mouse   198 VFVAIAFITMMIISLAWLIFYYI---------------QRFLYT---------GSQFGSQNHRKE 238

plant   122 DRSVIESLPV--FRFGALSGHKDGLECAVCLARFEPTEVLRLLPKCKHAFHVECVDTWLDAHSTC 184
            .:.||..||:  .:.|......|...||||:..|:..:|:|:|| |||.||..|:|.||..|.||
Mouse   239 TKKVIGQLPLHTVKHGEKGIDVDAENCAVCIENFKVKDVIRILP-CKHIFHRICIDPWLLDHRTC 302

plant   185 PLCR--------YRVDPEDI------------LLIGDCNSWFELQFSKDESNSVNNNPPGLTRFI 229
            |:|:        |..||||.            :.:|:.:     ..|:||..|.:|.|..     
Mouse   303 PMCKLDVIKALGYWGDPEDTQELPTPEAAPGRVSVGNLS-----VTSQDEERSESNLPSS----- 357

plant   230 PVSRISGRH-----SSAGERASRLNEIRTSSSY 257
             .|..||.|     ..|||..:.|...|:...:
Mouse   358 -SSSESGPHRPCLKEDAGEDTALLGAGRSEPQH 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATL43NP_196200.3 RING-H2_EL5_like 145..188 CDD:319375 22/42 (52%)
Rnf149NP_001028307.2 PA_GRAIL_like 45..181 CDD:239037
UPF0233 <193..>220 CDD:299753 7/21 (33%)
zf-RING_2 263..306 CDD:290367 22/43 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..394 17/80 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I4518
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.