DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATL43 and Rnf130

DIOPT Version :9

Sequence 1:NP_196200.3 Gene:ATL43 / 830466 AraportID:AT5G05810 Length:407 Species:Arabidopsis thaliana
Sequence 2:XP_038942740.1 Gene:Rnf130 / 652955 RGDID:1562041 Length:439 Species:Rattus norvegicus


Alignment Length:219 Identity:54/219 - (24%)
Similarity:87/219 - (39%) Gaps:53/219 - (24%)


- Green bases have known domain annotations that are detailed below.


plant    45 PPRHNFTSSLMPGIAVVIAVLTAFFSLTFLLLLYVKHCKRRNGSVYVNHPQRFAITRYGGGYYNG 109
            ||: ||:...:..:::...|| ...|..:|:..:::..:      |.|...|             
  Rat   186 PPK-NFSRGSLVFVSISFIVL-MIISSAWLIFYFIQKIR------YTNARDR------------- 229

plant   110 GGVVGGRKNSGIDRSVIESLP--VFRFGALSGHKDGLECAVCLARFEPTEVLRLLPKCKHAFHVE 172
                ..|:.....:..|..|.  ..:.|......|...||||:..::..:|:|:|| |||.||..
  Rat   230 ----NQRRLGDAAKKAISKLTTRTVKKGDKETDPDFDHCAVCIESYKQNDVVRVLP-CKHVFHKS 289

plant   173 CVDTWLDAHSTCPLCRYRVDPEDILLIG-----DC--NSWFELQFSKDESNSVNNNPPGLTRFIP 230
            |||.||..|.|||:|:..:    :..:|     .|  |..|:::              .|||...
  Rat   290 CVDPWLSEHCTCPMCKLNI----LKALGIVPNLPCTDNVAFDME--------------RLTRTQA 336

plant   231 VSRISGRHSSAGERASRLNEIRTS 254
            |:|.|.....|.:.:..|..:|||
  Rat   337 VNRRSALGDLANDSSLGLEPLRTS 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATL43NP_196200.3 RING-H2_EL5_like 145..188 CDD:319375 22/42 (52%)
Rnf130XP_038942740.1 PA_GRAIL_like 40..179 CDD:239037
HRD1 <197..366 CDD:227568 50/207 (24%)
RING-H2_RNF130 262..310 CDD:319717 23/52 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I4247
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.