DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATL43 and rnf38

DIOPT Version :9

Sequence 1:NP_196200.3 Gene:ATL43 / 830466 AraportID:AT5G05810 Length:407 Species:Arabidopsis thaliana
Sequence 2:XP_021331935.1 Gene:rnf38 / 566820 ZFINID:ZDB-GENE-030131-8693 Length:676 Species:Danio rerio


Alignment Length:217 Identity:61/217 - (28%)
Similarity:84/217 - (38%) Gaps:68/217 - (31%)


- Green bases have known domain annotations that are detailed below.


plant    19 VSLADNHTAV----VITTSDTPPPLPPPS------------------------------------ 43
            |.|..:|.:|    ....|..|.||||.:                                    
Zfish   470 VELLGDHLSVGGGFNYPHSGHPSPLPPSTPLQFLSHEPLHQELFGMPYPHFMPRRITGRRYRSQQ 534

plant    44 ---PPPRHNFTSSLMPGIAVVIAVL----TAFFSLTFLLLLYVKHCKRRNGSVYVNHPQRFAITR 101
               |||.|   .||:|...:|.:||    || ......|.|.|...:..|....:|..:|     
Zfish   535 AVPPPPYH---PSLLPYFLLVRSVLPVQPTA-VGPAISLELDVDDGEVENYEALLNLAER----- 590

plant   102 YGGGYYNGGGVVGGRKNSGIDRSVIESLPVFRFGALSGHKDGLECAVCLARFEPTEVLRLLPKCK 166
                       :|..|..|:.::.||.||.:||...:...:...|.||:..||..::||:|| |.
Zfish   591 -----------LGEAKPRGLTKADIEQLPSYRFNPSNHQSEQTLCVVCMCDFESRQLLRVLP-CN 643

plant   167 HAFHVECVDTWLDAHSTCPLCR 188
            |.||.:|||.||.|:.|||:||
Zfish   644 HEFHAKCVDKWLKANRTCPICR 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATL43NP_196200.3 RING-H2_EL5_like 145..188 CDD:319375 22/42 (52%)
rnf38XP_021331935.1 RING-H2_RNF38_like 621..665 CDD:319386 22/44 (50%)
RING-H2 finger (C3H2C3-type) 624..664 CDD:319386 22/40 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X146
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.