DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATL43 and Rnf44

DIOPT Version :9

Sequence 1:NP_196200.3 Gene:ATL43 / 830466 AraportID:AT5G05810 Length:407 Species:Arabidopsis thaliana
Sequence 2:XP_006253695.1 Gene:Rnf44 / 361212 RGDID:1307212 Length:433 Species:Rattus norvegicus


Alignment Length:151 Identity:51/151 - (33%)
Similarity:73/151 - (48%) Gaps:17/151 - (11%)


- Green bases have known domain annotations that are detailed below.


plant    38 PLPPPSPPPRHNFTSSLMPGIAVVIAVLTAFFSLTFLLLLYVKHCKRRNGSVYVNHPQRFAITRY 102
            |||||.|||..::..|.:|....::.:.......|..|.|.|...:..|....:|..:|      
  Rat   289 PLPPPPPPPPPSYYPSFLPYFLSMLPMSPTTVGPTISLDLDVDDVEMENYEALLNLAER------ 347

plant   103 GGGYYNGGGVVGGRKNSGIDRSVIESLPVFRFGALSGHKDGLECAVCLARFEPTEVLRLLPKCKH 167
                      :|..|..|:.::.||.||.:||...|...:...|.||.:.||..::||:|| |.|
  Rat   348 ----------LGDAKPRGLTKADIEQLPSYRFNPDSHQSEQTLCVVCFSDFEVRQLLRVLP-CNH 401

plant   168 AFHVECVDTWLDAHSTCPLCR 188
            .||.:|||.||.|:.|||:||
  Rat   402 EFHAKCVDKWLKANRTCPICR 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATL43NP_196200.3 RING-H2_EL5_like 145..188 CDD:319375 22/42 (52%)
Rnf44XP_006253695.1 zf-RING_2 381..422 CDD:290367 22/41 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X146
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.