DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATL43 and Rnf128

DIOPT Version :9

Sequence 1:NP_196200.3 Gene:ATL43 / 830466 AraportID:AT5G05810 Length:407 Species:Arabidopsis thaliana
Sequence 2:NP_001166820.1 Gene:Rnf128 / 315911 RGDID:1566282 Length:428 Species:Rattus norvegicus


Alignment Length:388 Identity:89/388 - (22%)
Similarity:122/388 - (31%) Gaps:153/388 - (39%)


- Green bases have known domain annotations that are detailed below.


plant    16 FLNVSLADNHTAVVITT----------SDTP-PP----LPPPSPP-------PRHNFTSSLMPGI 58
            :||||....|..|..|.          .|:| .|    |.||..|       |..|||...:.|.
  Rat    46 YLNVSWRVPHPGVNRTVWELSEEGVYGQDSPLEPVSGVLVPPDGPGALNACNPHTNFTVPTVWGS 110

plant    59 AVVI---AVLTAFFSLTFLLLLYVKHCKRRNGSVYVNHP-------------------------- 94
            .|.:   |::......||...:::.:.:..:|:|..|.|                          
  Rat   111 TVQVSWLALIQRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVIPMSHPGAGDIVAIMIGNLK 175

plant    95 --------QR------------------------------FAITRYGGGY---YNGGGVVGGRKN 118
                    ||                              |.||....||   |:...:...|..
  Rat   176 GTKILQSIQRGIQVTMVIEVGKKHGPWVNHYSIFFVSVSFFIITAATVGYFIFYSARRLRNARAQ 240

plant   119 S------------GIDRSVIESLPVFRFGALSGHK----DGLECAVCLARFEPTEVLRLLPKCKH 167
            |            .|.|..:.:|.       .|.|    ||..||||:..::|.:|:|:| .|.|
  Rat   241 SRKQRQLKADAKKAIGRLQLRTLK-------QGDKEIGPDGDSCAVCIELYKPNDVVRIL-TCNH 297

plant   168 AFHVECVDTWLDAHSTCPLCRYRVDPEDILLIGDCNSWFELQFSKD-ESNSVNNNPPGLTRFIPV 231
            .||..|||.||..|.|||:|:             |:....|....| |..||:..       :||
  Rat   298 IFHKTCVDPWLLEHRTCPMCK-------------CDILKALGIEVDVEDGSVSLQ-------VPV 342

plant   232 SRISGRHSSAGERASRLNEIRTSSSYKSNPMSFRRSLDSSLKVNDAGEEKSESVAVNCLDRLQ 294
            |..:...:|..|..:|..  ..||.|.|              |..|.|...|..|.:..:.||
  Rat   343 SNEASNTASPHEEDNRSE--TASSGYAS--------------VQGADEPPLEEHAQSANENLQ 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATL43NP_196200.3 RING-H2_EL5_like 145..188 CDD:319375 21/42 (50%)
Rnf128NP_001166820.1 PA_GRAIL_like 48..193 CDD:239037 28/144 (19%)
zf-RING_2 275..318 CDD:290367 21/43 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I4247
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.