DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATL43 and SPAC57A7.09

DIOPT Version :9

Sequence 1:NP_196200.3 Gene:ATL43 / 830466 AraportID:AT5G05810 Length:407 Species:Arabidopsis thaliana
Sequence 2:NP_593372.1 Gene:SPAC57A7.09 / 2542187 PomBaseID:SPAC57A7.09 Length:372 Species:Schizosaccharomyces pombe


Alignment Length:152 Identity:37/152 - (24%)
Similarity:53/152 - (34%) Gaps:53/152 - (34%)


- Green bases have known domain annotations that are detailed below.


plant    69 FSLTFLLLLYVKHCKRRNGSVYVNHPQRFAITRYGGGYYNGGGVVGGRKNSGIDRSVIESLP--- 130
            ||.:.::|:.|               |..||.::...|          :.....|..||.||   
pombe   243 FSPSIIMLITV---------------QALAIRKFIRTY----------RTKSKTRRFIEDLPSRT 282

plant   131 VFRFGALSGHKD-----------------------GLECAVCLARFEPTEVLRLLPKCKHAFHVE 172
            :.|.|..|..::                       |:||.:||..|...:.:..|| |||.||..
pombe   283 ISREGFYSEEEEIENSTQNGELVPLMDESTRRATFGVECVICLESFTKGDKVVALP-CKHEFHRP 346

plant   173 CVDTWL-DAHSTCPLCRYRVDP 193
            |:..|: |....||.|...|.|
pombe   347 CIAKWIVDYRHACPTCNTEVPP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATL43NP_196200.3 RING-H2_EL5_like 145..188 CDD:319375 17/43 (40%)
SPAC57A7.09NP_593372.1 COG5540 1..369 CDD:227827 37/152 (24%)
Peptidases_S8_S53 <144..211 CDD:299169
zf-RING_2 320..362 CDD:290367 17/42 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.