DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATL43 and SPAP32A8.03c

DIOPT Version :9

Sequence 1:NP_196200.3 Gene:ATL43 / 830466 AraportID:AT5G05810 Length:407 Species:Arabidopsis thaliana
Sequence 2:NP_594179.1 Gene:SPAP32A8.03c / 2542072 PomBaseID:SPAP32A8.03c Length:513 Species:Schizosaccharomyces pombe


Alignment Length:322 Identity:74/322 - (22%)
Similarity:115/322 - (35%) Gaps:107/322 - (33%)


- Green bases have known domain annotations that are detailed below.


plant    26 TAVVITTSDTPPPLPP-PSPP---------PRHNF-------------------TSSLMPGIAVV 61
            |:.:.::|.||||.|| ||.|         ||..|                   ||:..|..|..
pombe   230 TSPIFSSSSTPPPPPPRPSQPTSGESQNTNPRFPFSAQSFVFSVGPNGALHQVNTSTENPQNAQA 294

plant    62 IAV-LTAFFSLTFLLLLYVKHCKRRNGSVYVNHP-------QRFAITRYGGGYYNGGGVVG---- 114
            .|: :|...|:          .:|..||  :|.|       :.|.........:|..|..|    
pombe   295 GAIPITDLGSI----------LERIFGS--LNQPGAQQGEGEPFNPANMFSNIFNLSGNPGDYAW 347

plant   115 GRKNSGIDRSVIESLPVFRFGALSGH-------------------------KDGLECAVCLARFE 154
            |.:  |:| .:|..|    .....||                         ::| ||.:|:..|:
pombe   348 GAR--GLD-DIISQL----MEQAQGHNAPAPAPEDVIAKMKVQKPPKELIDEEG-ECTICMEMFK 404

plant   155 PTEVLRLLPKCKHAFHVECVDTWLDAHSTCPLCRYRVDPEDILLIGDCNSWFELQFSKDESNSVN 219
            ..:.:..|| |||.||..|:..||..:.||.:||..|||         ||......|.|.:|..|
pombe   405 INDDVIQLP-CKHYFHENCIKPWLRVNGTCAICRAPVDP---------NSQQRNNTSTDSANGHN 459

plant   220 NNPPGLTRFIPVSRISGRHSSAGERASRLNEIRTSSSYKSNPMSFRRSLDSSLKVNDAGEEK 281
                      |.:..:...|:..::.:.|.....:::.:|| :|......|...::|..:|:
pombe   460 ----------PSNHANPSTSTTNDQGATLRNESFNAASQSN-LSSEHGHSSRTPMDDFVDEE 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATL43NP_196200.3 RING-H2_EL5_like 145..188 CDD:319375 16/42 (38%)
SPAP32A8.03cNP_594179.1 HypA <1..34 CDD:302785
zf-RING_2 394..437 CDD:290367 17/44 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.