DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATL43 and hrd1

DIOPT Version :9

Sequence 1:NP_196200.3 Gene:ATL43 / 830466 AraportID:AT5G05810 Length:407 Species:Arabidopsis thaliana
Sequence 2:NP_596376.1 Gene:hrd1 / 2539900 PomBaseID:SPBC17D11.02c Length:677 Species:Schizosaccharomyces pombe


Alignment Length:189 Identity:39/189 - (20%)
Similarity:64/189 - (33%) Gaps:67/189 - (35%)


- Green bases have known domain annotations that are detailed below.


plant   146 CAVCLAR-FEP------TEVLRLLPK----------CKHAFHVECVDTWLDAHSTCPLCRYRVDP 193
            |.:|... |.|      |:.:..||:          |.|..|..|:..||:...|||:||..|  
pombe   292 CTICREEMFHPDHPPENTDEMEPLPRGLDMTPKRLPCGHILHFHCLRNWLERQQTCPICRRSV-- 354

plant   194 EDILLIGDCNS-------------WFELQFSKDESNSVNNNPPGLTRFIPVSRISGRHSSAGE-R 244
                 ||:.:|             ....|....::.......||:|          ..|:.|: :
pombe   355 -----IGNQSSPTGIPASPNVRATQIATQVPNPQNTPTTTAVPGIT----------NSSNQGDPQ 404

plant   245 ASRLNEIRTSSSYKSNPMSFRRSLDSSLKVNDAGEEKSESVAVNCLDRLQRKDGLLLIP 303
            ||..|.:..::|  |...:..:.|.|.:.                 .|:..:||..::|
pombe   405 ASTFNGVPNANS--SGFAAHTQDLSSVIP-----------------RRIALRDGWTMLP 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATL43NP_196200.3 RING-H2_EL5_like 145..188 CDD:319375 16/58 (28%)
hrd1NP_596376.1 HRD1 1..514 CDD:227568 39/189 (21%)
zf-RING_2 291..351 CDD:290367 16/58 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.