DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATL43 and RNF38

DIOPT Version :9

Sequence 1:NP_196200.3 Gene:ATL43 / 830466 AraportID:AT5G05810 Length:407 Species:Arabidopsis thaliana
Sequence 2:NP_073618.3 Gene:RNF38 / 152006 HGNCID:18052 Length:515 Species:Homo sapiens


Alignment Length:166 Identity:53/166 - (31%)
Similarity:76/166 - (45%) Gaps:34/166 - (20%)


- Green bases have known domain annotations that are detailed below.


plant    36 PPPLP-------------PPSPPPRHNFTSSLMPGIAVVIAVLTAFFSLTFLLLLYVKHCKRRNG 87
            ||.:|             |..|||.|   .||:|.:..::.|..| ...||...|.|:..:..|.
Human   360 PPFMPRRLTGRSRYRSQQPIPPPPYH---PSLLPYVLSMLPVPPA-VGPTFSFELDVEDGEVENY 420

plant    88 SVYVNHPQRFAITRYGGGYYNGGGVVGGRKNSGIDRSVIESLPVFRFGALSGHKDGLECAVCLAR 152
            ...:|..:|                :|..|..|:.::.||.||.:||...:...:...|.||:..
Human   421 EALLNLAER----------------LGEAKPRGLTKADIEQLPSYRFNPNNHQSEQTLCVVCMCD 469

plant   153 FEPTEVLRLLPKCKHAFHVECVDTWLDAHSTCPLCR 188
            ||..::||:|| |.|.||.:|||.||.|:.|||:||
Human   470 FESRQLLRVLP-CNHEFHAKCVDKWLKANRTCPICR 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATL43NP_196200.3 RING-H2_EL5_like 145..188 CDD:319375 22/42 (52%)
RNF38NP_073618.3 Bipartite nuclear localization signal 1 57..71
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..141
Bipartite nuclear localization signal 2 115..131
RING-H2_RNF38_like 460..504 CDD:319386 22/44 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X146
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.