DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT5G05280 and si:ch211-59o9.10

DIOPT Version :10

Sequence 1:NP_196147.1 Gene:AT5G05280 / 830410 AraportID:AT5G05280 Length:176 Species:Arabidopsis thaliana
Sequence 2:NP_001352283.2 Gene:si:ch211-59o9.10 / 561841 ZFINID:ZDB-GENE-101206-1 Length:474 Species:Danio rerio


Alignment Length:79 Identity:31/79 - (39%)
Similarity:48/79 - (60%) Gaps:2/79 - (2%)


- Green bases have known domain annotations that are detailed below.


plant    83 ANVAKG-IKKRALKVIPVDSYSPELKMKATECLICLGDFVEGETVRVLPKCNHGFHVKCIDTWLL 146
            |.:||. :.|..::.:|:.:|.|......|:|.||..::..||.:|:|| |.|.:||||||.||.
Zfish   392 AVMAKNTLSKAEIERLPIKTYDPTHSAGKTDCQICFSEYKAGERLRMLP-CLHDYHVKCIDRWLK 455

plant   147 SHSSCPTCRQSLLE 160
            .:::||.||..:.|
Zfish   456 ENATCPICRADVSE 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT5G05280NP_196147.1 RING-H2_EL5-like 112..155 CDD:438124 20/42 (48%)
si:ch211-59o9.10NP_001352283.2 None

Return to query results.
Submit another query.